Property Summary

NCBI Gene PubMed Count 278
PubMed Score 3939.49
PubTator Score 2004.71

Knowledge Summary


No data available


  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Disease Target Count Z-score Confidence
Connective tissue disease 62 0.0 3.0
Systemic lupus erythematosus 194 0.0 3.0
Disease Target Count


  Differential Expression (20)

Disease log2 FC p
lung cancer -2.300 5.1e-03
tuberculosis 2.000 9.1e-07
adrenocortical carcinoma -1.802 1.9e-04
astrocytoma 1.600 3.4e-02
cutaneous lupus erythematosus 1.600 2.0e-02
Duchenne muscular dystrophy 1.060 1.2e-06
group 3 medulloblastoma -1.700 1.4e-04
head and neck cancer and chronic obstruc... 1.100 1.1e-03
interstitial cystitis 1.300 8.1e-03
intraductal papillary-mucinous adenoma (... -1.600 2.1e-02
invasive ductal carcinoma 1.713 1.2e-04
lung carcinoma -1.900 1.0e-21
malignant mesothelioma 4.100 1.2e-07
medulloblastoma, large-cell -1.200 2.1e-02
mucosa-associated lymphoid tissue lympho... 2.090 1.9e-02
non-small cell lung cancer -1.238 4.4e-08
osteosarcoma -3.899 5.2e-05
ovarian cancer -3.100 3.4e-09
subependymal giant cell astrocytoma 1.685 3.0e-02
ulcerative colitis 1.600 9.1e-05

Gene RIF (237)

AA Sequence

ALITAALYKLGFFKRQYKDMMSEGGPPGAEPQ                                         1121 - 1152

Text Mined References (280)

PMID Year Title