Property Summary

NCBI Gene PubMed Count 158
PubMed Score 749.25
PubTator Score 1456.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
ulcerative colitis 1.800 3.8e-04
cutaneous lupus erythematosus 3.000 8.8e-05
osteosarcoma -4.542 4.0e-08
periodontitis 1.300 5.4e-28
glioblastoma 1.200 2.4e-02
Atopic dermatitis 1.100 2.3e-02
tuberculosis 1.500 1.6e-08
non-small cell lung cancer -1.609 2.9e-16
lung cancer -2.700 1.4e-05
interstitial cystitis 2.100 3.6e-03
pediatric high grade glioma 1.300 6.0e-04
pilocytic astrocytoma 1.300 3.9e-07
primary Sjogren syndrome 1.100 8.6e-03
psoriasis 1.100 1.8e-06
COPD -1.200 6.8e-04
lung carcinoma -2.700 4.6e-33
spina bifida 1.000 3.9e-02

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (144)

PMID Text
26936951 The alphaI domain, tethered through its N-linker and a disulfide to a stable beta-ribbon pillar near the center of the platform, can undergo pivoting and tilting motions that appear buffered by N-glycan decorations that differ between alphaL and alphaX subunits.
26884833 Suggest possible role for lymphocyte CD11a in the pathogenesis immune thrombocytopenia.
26216891 Data show that interleukin-18 was involved in the eosinophil-mediated death of colon carcinoma cells via upregulation of CD11a/CD18 and ICAM-1 adhesion molecules.
25684021 Data show that leucocyte function-associated antigen-1 (integrin alphaLbeta2), DNAX accessory molecule-1 (DNAM-1) or tumour necrosis factor-related apoptosis-inducing ligand (TRAIL) enhance osteoclast survival when co-cultured with activated NK cells.
25678252 the blocking of LFA-1/ICAM-1 interaction resulted in a significant increase in the percentage of IL-17(+) T cells expanded in nonclassical monocyte/T-cell cocultures
25378583 LFA-1 function is regulated through conformational changes that include the modulation of ligand binding affinity and molecular extension.
25231265 beta2 integrins-mediated chemosensory adhesion and migration of polymorphonuclear leukocytes on the vascular graft surface, bacterial cellulose.
25155097 CD11a, CD11c, and CD18 gene polymorphisms and susceptibility to Behcet's disease in Koreans.
25147050 Studied signaling mechanisms of Lymphocyte function-associated antigen-1 (LFA-1) using NMR analysis of the dynamics of the LFA-1 I-domain.
24982892 PIK3R3, ITGB1, ITGAL, and ITGA6, were involved in the regulation of actin cytoskeleton that link to triple-negative breast cancer migration.
24829201 there was reduced expression of CD11a, CD11b, and CD18 in trisomy 12 cases with NOTCH1 mutations compared with wild type.
24276331 shear-induced CD11/CD18 cleavage is phenotypic of neutrophilic cells, including those derived from HL60 cells
24238281 ITGAL is overexpressed in systemic lupus erythematosus CD4+ T cells, but expression is not linked to the typical clinical and serological parameters associated with the disease.
24006483 Data indicate that CD47 in cis interactions regulate LFA-1 (integrin alphaLbeta2) and VLA-4 (integrin alpha4beta1) integrin affinity, and this process plays a substantial role in the adhesion of T-cells.
23981064 Distribution of integrin beta(2) is also markedly altered in M. tuberculosis-infected DCs. A corresponding reduction in the alphaL (CD11a) and alphaM (CD11b) subunits that associate with integrin beta(2) was also observed.
23726040 genetic polymorphism is associated with atopic disease and relevant allergic indices
23590845 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
23514737 Binding kinetics differences between LFA-1 and macrophage-1 antigen (Mac-1) are quantified and insight provided into their distinct functions in the neutrophil inflammatory cascade.
23450818 We conclude, that deficiency of CD11a expression should be added to the diagnostic criteria of AML-M7, classical DS-AML and TMD.
23418509 The results of this study suggest that polyamine-induced suppression of LFA-1 expression occurs via enhanced methylation of ITGAL.
23398146 Allele frequencies were determined in the blood donor population as follows: 0.318 for HNA-1a, 0.668 for HNA-1b, 0.014 for HNA-1c, 0.768 for HNA-3a, 0.232 for HNA-3b, 0.882 for HNA-4a, 0.118 for HNA-4b, 0.736 for HNA-5a and 0.264 for HNA-5b.
23202514 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
23188505 Flow-based adhesion assay showed that engagement of CD103 or LFA-1, together with TCR, enhances the strength of the T-cell/target cell interaction
23160181 common and rare variants in FTO, SERPINA12, and ITGAL predict PON1 acti
22908191 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
22467872 Binding of LtxA to LFA-1 resulted in the internalization of both LtxA and LFA-1, with LtxA localizing specifically to the lysosomal compartment.
22411821 This work demonstrates an intricate coupling between conformation and lateral diffusion of LFA-1 and further underscores the crucial role of mobility for the onset of LFA-1 mediated leukocyte adhesion.
22384114 Cytotoxicity of CD56(bright) NK cells towards autologous activated CD4+ T cells is mediated through NKG2D, LFA-1 and TRAIL and dampened via CD94/NKG2A
22206678 DNA hypermethylation at the CD11a locus contributes to the lowered expression of CD11a in biliary atresia CD4+ T cells.
22190034 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
21850260 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
21705617 Regulator of G protein signaling (RGS) represses Galpha-dependent signaling during chemokine-activated integrin alphaLbeta2- and alpha4beta1- dependent T cell adhesion.
21669874 N-terminal myr-tagged SKAP1 for membrane binding facilitated constitutive RapL membrane and Rap1 binding and effectively substituted for PI3K and TCR ligation in the activation of LFA-1 in T cells.
21597477 Studies indicate that transformation of LFA1 from a bent, resting form to an extended conformation is essential for T cell migration and the formation of an immunological synapse.
21576384 Bordetella pertussis adenylate cyclase toxin binds to T cells via LFA-1 and induces its disengagement from the immune synapse
21541792 CD70 and CD11a facilitate the survival of T and B lymphocytes and indirectly enhance the destruction of platelets in immune thrombocytopenia.
21540444 hyperketonemia can induce monocyte adhesion to endothelial cells and it is mediated via increased ICAM-1 expression in endothelial cells and increased expression and affinity of LFA-1 in monocytes
21454358 We show that sequential cleavage of C-terminal amino acids from the beta(2) cytoplasmic tail of LFA-1, by cathepsin X, enhances binding of the adaptor protein talin to LFA-1 and triggers formation of the latter's high-affinity form
21284901 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
21270395 2B4-mediated increase in natural killer (NK) cell adhesion to tumor targets is actin- and LFA-1-dependent, demonstrating that inside-out signaling is very fast and its effects can be detected as early as 90 seconds after cell contact.
21206905 LFA-1-induced stabilization of ARE-containing mRNAs in T cells is dependent on HuR, and occurs through the Vav-1, Rac1/2, MKK3 and p38MAPK signaling cascade
21192791 RFX1 recruits SUV39H1 to the promoter regions of the CD11a and CD70 genes in CD4(+) T cells, thereby regulating local H3K9 tri-methylation levels.
21152086 Findings support the idea that calpain is involved in the turnover of LFA-1 adhesions at the rear of the cell.
20953905 Observational study of gene-disease association. (HuGE Navigator)
20890395 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
20681010 the high-affinity state of LFA-1 on T cells is critical to induce targeted movements of both ICAM-1 and MHC class II to the immunological synapse on APCs.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20574620 Case Report: Possible acceleration of regression by antibiotic treatment in benign cephalic histiocytosis with infiltration of CD11a/CD11c+ macrophages.
20516718 Decreased chemotactic response and downregulated expression of CD11a in an experimental model of depression could be an important mechanisms to induce impaired immune responses in experimental and clinical depression.
20511548 T helper (Th)17 cells adhere to mesenchymal stem cells through the joined involvement of CCR6 and CD11a/CD18 and their respective ligands, interactions that induce a regulatory phenotype in fully polarized tissue-infiltrating Th17 cells.
20445017 Human neutrophil rolling on E- or P-selectin induces the extended alpha(L)beta(2) integrin conformation through signaling triggered by PSGL-1 engagement.
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20338181 These results provide an example of the stabilizing effect of polar interactions within the low dielectric environment of the membrane interior and demonstrate its importance in the regulation of alpha L beta 2 function.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19721069 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
19641037 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
19502238 LFA-1 and CD2 synergize for the Erk1/2 activation in the Natural Killer (NK) cell immunological synapse
19268609 high-affinity LFA-1 integrin
19211748 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
19135988 Data confirmed the increased monocyte alphaL, alphaM and beta2 integrin subunits in diabetes mellitus.
19050286 Dimeric bond clusters of LFA-1/intercellular adhesion molecule-1 (ICAM-1) provide a key outside-in signal for orienting cytoskeletal dynamics that direct neutrophil extravasation at sites of inflammation.
19029120 These data suggest that disruption of the TM interface changes alphaLbeta2 ligand binding affinity, and it may contribute to alphaL micro-cluster formation
18922916 Rap1-induced activation of both alpha4beta1 and alphaLbeta2 is defective, autocrine VEGF and chemokine are necessary to activate alpha4beta1 for ligand binding.
18339898 BCR-ABL1 in malignant cells constitutively increases expression of activation-dependent epitopes of LFA-1 and complete loss of responsiveness of LFA-1 to SDF-1-induced "inside-out" signaling involving CXCR4 and Lyn, leading to aberrant adhesive responses
18264102 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
18199751 MEM83 stabilizes adjacent LFA-1 molecules in their active form by the free energy that is gained from the binding of the I-domains to each arm of the IgG
18195072 during T lymphocyte migration, uropodal adhesion depends on LFA-1 avidity, where MyH9 serves as a key mechanical link between LFA-1 and the cytoskeleton that is critical for LFA-1 de-adhesion
18156711 Observational study of genotype prevalence. (HuGE Navigator)
18079697 Distinctive roles for intermediate- and high-affinity LFA-1 in T lymphocyte migration provides a biological function for two active conformations of this integrin.
17913807 Here we demonstrate that leukocyte function-associated antigen 1 (LFA-1), intercellular adhesion molecule 1 (ICAM-1), and ICAM-3 are enriched at the VS and that inhibition of these interactions influences conjugate formation and reduces VS assembly.
17785425 The fungal enzyme cutinase and its suicide substrate p-nitrophenyl phosphonate were used to covalently attach a variety of labels to LFA-1 on the surface of living cells.
17673459 analysis of the leukocyte beta2 integrins and interpretation of the transition between the resting and active states of leukocyte function-associated antigen-1
17591777 talin induced an intermediate affinity alphaLbeta2 that adhered constitutively to its ligand intercellular adhesion molecule (ICAM)-1 but not ICAM-3.
17486117 Thus, LFA-1 acts through PLD2 to reshape the pattern of Ras activation downstream of the TCR.
17468108 integrins alphaLbeta2 and alphaIIbbeta3 are activated by mutation of a conserved asparagine in the I-like domain
17430469 VCAM1 expression in LME cells and LFA-1 expression in HLA-DR15-positive monocytes were enhanced after combined culture of LME cells, HLA-DR15-positive monocytes and TRALI-inducing anti-HLA DR15 antibody-positive serum
17078873 activation of LFA-1 is crucial for efficient dendritic cell mediated HIV-1 transmission as demonstrated in LFA-1 defective leukocytes from Leukocyte Adhesion Deficiency type 1 (LAD-1) patients.
17078873 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
17045822 Negative stain electron microscopy was used to examine the conformational changes in the ectodomains required for activation of the leukocyte integrins alpha(X)beta(2) and alpha(L)beta(2).
17038526 under shear stress, T cells encountering apically presented CXCL12 were primed to undergo robust LFA-1-dependent transendothelial migration toward subendothelial CCL5.
16963559 Data characterize a monoclonal Ab, AL-57 (activated LFA-1 clone 57), that has been developed by phage display that selectively targets the HA open conformation of the LFA-1 I domain.
16920795 Beta(2) I domain metal ion-binding sites regulate alpha(L) I domain affinity, and the adjacent to metal ion-dependent adhesion site (ADMIDAS) is required for outside-in signaling.
16918410 Review provides overview of the established role of LFA-1 in trafficking and activation of leukocytes and includes recent elucidation of the global conformational changes that govern its function.
16855029 Besides affinity regulation, LFA-1 function is controlled by at least three different avidity patterns: random distributed inactive molecules, well-defined ligand-independent proactive nanoclusters, and ligand-triggered micrometer-sized macroclusters.
16705652 allosteric antagonists work by eliminating breathing motion that leads to the open conformation of the I-domain when LFA1 and ICAM1 bind
16622014 indicate that HTLV-1 p12(I), in addition to enhancing T cell activation, promotes cell-to-cell spread by inducing LFA-1 clustering on T cells via calcium-dependent signaling
16505487 the integrin alphaLbeta2 intermediate affinity state has a role in transition from rolling to firm adhesion
16492228 Down-regulation of LFA-1 expression by lymphocytes could antagonize their transvascular migration, supporting the hypothesis of sterile inflammation in the dura mater during migraine attacks.
16472601 Effect of the hepatitis C envelope protein E2 on LFA-1-stimulated T-cell migration.
16301335 LFA-1 activation is regulated differently through affinity-dependent and -independent mechanisms by integrin alpha and beta chains
16249234 We demonstrate that cell movement in response to IL-8 is mediated by Mac-1, whereas LFA-1 is required for directional migration. By contrast, chemotaxis to fMLP requires Mac-1 for cell movement.
16207819 In primary neutrophils unengaged LFA-1 is internalized and rapidly recycled upon chemoattractant stimulation via a clathrin-independent, cholesterol-sensitive pathway.
16100282 biophysical analysis of how lymphocyte function-associated antigen-1 mediates rolling of polystyrene particles on ICAM-1 under flow
16038038 lymphocyte-induced destruction through adhesion by ICAM-1 and binding of LFA-1-expressing activated lymphocytes takes place not only in bile ductules but also in the canal of Hering in biliary cirrhosis
16037628 In DVT subjects, at baseline, the phenotypical expression of CD11b was decreased and that of CD11c was increased, and upon PMN activation in DVT subjects CD11b, CD11c and CD18 increased, while CD11a expression did not show any change
16002691 LFA-1 activation state and cluster formation mediate the initial steps of HIV-1 binding and entry inside activated CD4+ T lymphocytes.
15983060 Talin is essential for the stability and formation of the LFA-1 zone. Disruption of the talin-integrin link leads to loss of zone integrity and a substantial decrease in speed of migration on ICAM-1.
15958383 the hybrid domain of integrin alphaL beta2 has different requirements of affinity states for ICAM-1 and ICAM-3 binding
15851656 LFA-1 delivers a distinct signal essential for directing released cytolytic granules to the surface of antigen-bearing target cells to mediate the effective destruction of these cells by cytotoxic T lymphocytes.
15834409 chemokine-triggered lymphocyte adhesiveness involves a previously unrecognized extension step that primes LFA-1 for ligand binding and firm adhesion
15730520 Observational study of gene-disease association. (HuGE Navigator)
15693793 CD226 molecules play an important role in maturation of the megakaryocytes in combination with LFA-1
15622747 Acute myeloid leukemia cells might adhere to and get through vascular endothelium by CD49d/VCAM-1 and CD11a/ICAM-1 adhesion mechanism.
15611342 The LFA-1 clustering does not precede ligand binding, and instead functions in adhesion strengthening after binding to multivalent ligands.
15356110 In contrast to T cells, in which even adhesion through LFA-1 is dependent on signals from other receptors, natural killer (NK) cells receive early activation signals directly through LFA-1.
15308572 Usinsg monoclonal antibodies to LFA-1alpha on monocytic cells, found that cellular adhesion to vascular cell adhesion molecule 1 (VCAM-1) mediated by very late antigen 4 (VLA-4) was suppressed after this treatment.
15240749 LFA-1 to ICAM-1 adhesion is initiated by the formation of a single bond with approximately 0.3 s(-1) dissociation rate, and attachment is subsequently strengthened by the formation of additional bonds during the next 10 s.
15222882 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
15208262 The ICAM-1/LFA-1 association was a more efficient transmission factor for HIV-1 bearing ICAM-1 than combined gp120/DC-SIGN & ICAM-3/DC-SIGN. The involvement of virus-bound ICAM-1 & LFA-1 in virus binding & carriage was confirmed in human lymphoid tissues.
15183063 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
15113754 results identify novel, specific functional consequence of LFA-1-mediated cytolytic activity in perforin-containing human NK subsets
14722085 integrin LFA-1 binds to the plasma membrane phosphoprotein RanBPM and is coupled to integrins with intracellular signaling pathways
14695458 Increased expression or CD11A may affect the development of initial atherosclerotic coronary stenosis, but not re-stenosis.
14688105 TNF-alpha acts as a potent stimulator of Actinobacillus actinomycetemcomitans leukotoxin-induced HL-60 cell apoptosis via TNF receptor 1-mediated upregulation of LFA-1 expression.
14676297 CD226 is involved in LFA-1-mediated costimulatory signals for triggering naive T cell differentiation and proliferation.
12855590 RUNX3/AML-2 binding to the CD11a promoter correlates with increased RUNX3/AML-2 protein levels and enhanced CD11a/CD18 cell surface expression
12847234 A major cause of the poor cytotoxic activity of IL-7-differentiated cells is their low expression of LFA-1, an important marker for the development of competent natural killer (NK) cells following bone marrow transplantation.
12815062 LFA-1 and TCR have essential roles in encounters of T cells with antigen-presenting cells and immunological synapse (IS) formation
12694184 ICAM-4 binds to the I domain of this integrin.
12616499 Vav1 transduces TCR signals required for LFA-1 function and cell polarization at the immunological synapse.
12516552 Adhesion of dendritic cells derived from CD34+ progenitors to resting human dermal microvascular endothelial cells is down-regulated upon maturation and partially depends on CD11a-CD18, CD11b-CD18 and CD36.
12368450 Increased expression in Mycobacterium tuberculosis-infected human macrophages exhibiting enhanced cellular adhesion
12207338 Porphyromonas gingivalis fimbriae activate human peripheral blood monocytes utilizing TLR2, CD14 and CD11a/CD18 as cellular receptors.
12202941 study demonstrates a role for the LFA-1 interaction with ICAM-1 in the lysis of bladder tumor cells by (BCG)-activated killer (BAK) and lymphokine-activated killer (LAK) cells
12163503 LFA-1 integrin activation by chemokines requires cholesterol
12163056 results indicated that the constitutive CD11a expression in the myeloid lineage is implicated in oxidative stress occurring spontaneously
12139949 there are increased CD4+ cells in ulcerative colitis and Crohn's disease and there is enhanced expression of CD11a by this T-cell subset
12117984 cagA+ Helicobacter pylori induced homotypic aggregation of macrophage-like cells by up-regulation and recruitment of intracellular adhesion molecule 1 to the cell surface and mediates the aggregation via LFA-1
12036881 Effect of DNA methylation and chromatin structure on ITGAL tissue-specific expression.
12020947 hypomethylation of regions flanking the ITGAL promoter may increase CD11a expression and may be one mechanism contributing to increased T cell gene expression with aging
11953106 cd11a may play an important role in pathogenic process(in COPD)
11929876 regulation of LFA-1 activation and neutrophil arrest on intercellular adhesion molecule 1 in shear flow
11867690 important role for the integrin LFA-1 and the microtubular cytoskeleton in the Ca(2)(+)-mediated activation of PYK2 in T-lymphocytes
11792712 Activation-induced conformational changes in the I domain region of lymphocyte function-associated antigen 1
9743356 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
9341793 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
9263011 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
8450224 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
8086129 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
7917519 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
7904170 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
2543075 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
1967280 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120
1757107 HIV-1 replication is delayed in LFA-1 negative T cells after Dendritic cell (DC)-mediated transmission; activation of LFA-1 is crucial for efficient DC-mediated HIV-1 transmission, suggesting an interaction between LFA-1 and HIV-1 gp120

AA Sequence

MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGAPGEGNSTGSL      1 - 70
YQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCDQNTYLSGLCYLFRQNLQGPM     71 - 140
LQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSD    141 - 210
YVKRKDPDALLKHVKHMLLLTNTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDII    211 - 280
RYIIGIGKHFQTKESQETLHKFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELS    281 - 350
SSGISADLSRGHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLL    351 - 420
ASGAPRYQHMGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLIGAPLFYGEQR    421 - 490
GGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVAVGAPLEEQGAVYIFNGRHGG    491 - 560
LSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVAVGAESQMIVLSSRPVVDMVTLMSFSPAEIP    561 - 630
VHEVECSYSTSNKMKEGVNITICFQIKSLIPQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIA    631 - 700
VTTSMSCTDFSFHFPVCVQDLISPINVSLNFSLWEEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEKN    701 - 770
CGEDKKCEANLRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQ    771 - 840
IPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTCNNEDSDLLED    841 - 910
NSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPS    911 - 980
EGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFS    981 - 1050
LCSSLSISFNSSKHFHLYGSNASLAQVVMKVDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRN   1051 - 1120
LKEKMEAGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSESGGGKD                       1121 - 1170
//

Text Mined References (165)

PMID Year Title
27055590 2016 LFA-1 and Mac-1 integrins bind to the serine/threonine-rich domain of thrombomodulin.
26936951 2016 Leukocyte integrin ?L?2 headpiece structures: The ?I domain, the pocket for the internal ligand, and concerted movements of its loops.
26884833 2015 Expression of CD11a in lymphocyte subpopulation in immune thrombocytopenia.
26216891 2015 IL-18 Is Involved in Eosinophil-Mediated Tumoricidal Activity against a Colon Carcinoma Cell Line by Upregulating LFA-1 and ICAM-1.
25684021 2015 Interleukin-15-activated natural killer cells kill autologous osteoclasts via LFA-1, DNAM-1 and TRAIL, and inhibit osteoclast-mediated bone erosion in vitro.
25678252 2015 Blocking of LFA-1 enhances expansion of Th17 cells induced by human CD14(+) CD16(++) nonclassical monocytes.
25378583 2015 FRET detection of lymphocyte function-associated antigen-1 conformational extension.
25231265 2015 ?2 integrins (CD11/18) are essential for the chemosensory adhesion and migration of polymorphonuclear leukocytes on bacterial cellulose.
25155097 2014 CD11a, CD11c, and CD18 gene polymorphisms and susceptibility to Behçet's disease in Koreans.
25147050 2014 NMR characterization of the conformational fluctuations of the human lymphocyte function-associated antigen-1 I-domain.
24982892 2014 Computational analysis of mRNA expression profiles identifies the ITG family and PIK3R3 as crucial genes for regulating triple negative breast cancer cell migration.
24829201 2014 Trisomy 12 chronic lymphocytic leukemia cells exhibit upregulation of integrin signaling that is modulated by NOTCH1 mutations.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24276331 2014 Characterization of the shear stress regulation of CD18 surface expression by HL60-derived neutrophil-like cells.
24238281 Clinical and serological findings associated with the expression of ITGAL, PRF1, and CD70 in systemic lupus erythematosus.
24006483 2013 CD47 plays a critical role in T-cell recruitment by regulation of LFA-1 and VLA-4 integrin adhesive functions.
23981064 2014 Mycobacterium tuberculosis infection of human dendritic cells decreases integrin expression, adhesion and migration to chemokines.
23775590 2013 Novel role of ICAM3 and LFA-1 in the clearance of apoptotic neutrophils by human macrophages.
23726040 2014 CD11a polymorphisms regulate TH2 cell homing and TH2-related disease.
23514737 2013 Distinct binding affinities of Mac-1 and LFA-1 in neutrophil activation.
23450818 Blast cell deficiency of CD11a as a marker of acute megakaryoblastic leukemia and transient myeloproliferative disease in children with and without Down syndrome.
23418509 2013 Suppression of LFA-1 expression by spermine is associated with enhanced methylation of ITGAL, the LFA-1 promoter area.
23398146 2013 Determination of human neutrophil antigen-1, -3, -4 and -5 allele frequencies in English Caucasoid blood donors using a multiplex fluorescent DNA-based assay.
23188505 2013 CD103 or LFA-1 engagement at the immune synapse between cytotoxic T cells and tumor cells promotes maturation and regulates T-cell effector functions.
23160181 2013 Novel common and rare genetic determinants of paraoxonase activity: FTO, SERPINA12, and ITGAL.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22467872 2012 Leukotoxin (Leukothera®) targets active leukocyte function antigen-1 (LFA-1) protein and triggers a lysosomal mediated cell death pathway.
22411821 2012 Lateral mobility of individual integrin nanoclusters orchestrates the onset for leukocyte adhesion.
22384114 2012 Cytotoxicity of CD56(bright) NK cells towards autologous activated CD4+ T cells is mediated through NKG2D, LFA-1 and TRAIL and dampened via CD94/NKG2A.
22206678 2012 Abnormal DNA methylation of ITGAL (CD11a) in CD4+ T cells from infants with biliary atresia.
21705617 2011 RGS10 restricts upregulation by chemokines of T cell adhesion mediated by ?4?1 and ?L?2 integrins.
21669874 2011 SKAP1 protein PH domain determines RapL membrane localization and Rap1 protein complex formation for T cell receptor (TCR) activation of LFA-1.
21597477 2011 The insider's guide to leukocyte integrin signalling and function.
21576384 2011 The Bordetella pertussis adenylate cyclase toxin binds to T cells via LFA-1 and induces its disengagement from the immune synapse.
21541792 2011 Effects of CD70 and CD11a in immune thrombocytopenia patients.
21540444 2011 Hyperketonemia increases monocyte adhesion to endothelial cells and is mediated by LFA-1 expression in monocytes and ICAM-1 expression in endothelial cells.
21454358 2011 Cathepsin X cleavage of the beta2 integrin regulates talin-binding and LFA-1 affinity in T cells.
21270395 2011 2B4 engagement mediates rapid LFA-1 and actin-dependent NK cell adhesion to tumor cells as measured by single cell force spectroscopy.
21206905 2010 T cell LFA-1 engagement induces HuR-dependent cytokine mRNA stabilization through a Vav-1, Rac1/2, p38MAPK and MKK3 signaling cascade.
21192791 2010 RFX1 regulates CD70 and CD11a expression in lupus T cells by recruiting the histone methyltransferase SUV39H1.
21152086 2010 Calpain 2 controls turnover of LFA-1 adhesions on migrating T lymphocytes.
20953905 2011 LFA-1 gene polymorphisms are associated with the sporadic infiltrative duct breast carcinoma in Chinese Han women of Heilongjiang Province.
20681010 2010 Recycling and LFA-1-dependent trafficking of ICAM-1 to the immunological synapse.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20574620 2010 Possible acceleration of regression by antibiotic treatment in benign cephalic histiocytosis with infiltration of CD11a/CD11c+ macrophages.
20516718 2010 Forced swimming test decreases chemotactic responsiveness and expression of CD11a in rat monocytes.
20511548 2010 Mesenchymal stem cells inhibit human Th17 cell differentiation and function and induce a T regulatory cell phenotype.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20445017 2010 Rolling on E- or P-selectin induces the extended but not high-affinity conformation of LFA-1 in neutrophils.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20338181 2010 A transmembrane polar interaction is involved in the functional regulation of integrin alpha L beta 2.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19502238 2009 LFA-1 and CD2 synergize for the Erk1/2 activation in the Natural Killer (NK) cell immunological synapse.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19268609 2009 Lymphocyte crawling and transendothelial migration require chemokine triggering of high-affinity LFA-1 integrin.
19234460 2009 A point mutation in KINDLIN3 ablates activation of three integrin subfamilies in humans.
19135988 2009 Increased monocyte alphaL, alphaM and beta2 integrin subunits in diabetes mellitus.
19050286 2008 Transmigration of neutrophils across inflamed endothelium is signaled through LFA-1 and Src family kinase.
19029120 2009 Disruption of the integrin alphaLbeta2 transmembrane domain interface by beta2 Thr-686 mutation activates alphaLbeta2 and promotes micro-clustering of the alphaL subunits.
18985028 2008 Hepatitis C virus infection protein network.
18922916 2008 Cell motility in chronic lymphocytic leukemia: defective Rap1 and alphaLbeta2 activation by chemokine.
18339898 2008 BCR-ABL1 alters SDF-1alpha-mediated adhesive responses through the beta2 integrin LFA-1 in leukemia cells.
18199751 2008 A mechanism for antibody-mediated outside-in activation of LFA-1.
18195072 2008 Nonmuscle myosin heavy chain IIA mediates integrin LFA-1 de-adhesion during T lymphocyte migration.
18156711 2006 Gene frequencies of human neutrophil antigens 4a and 5a in the korean population.
18079697 2008 Intermediate-affinity LFA-1 binds alpha-actinin-1 to control migration at the leading edge of the T cell.
17913807 2007 Adhesion molecule interactions facilitate human immunodeficiency virus type 1-induced virological synapse formation between T cells.
17785425 2007 Specific and covalent labeling of a membrane protein with organic fluorochromes and quantum dots.
17673459 2007 A structural hypothesis for the transition between bent and extended conformations of the leukocyte beta2 integrins.
17591777 2007 The cytosolic protein talin induces an intermediate affinity integrin alphaLbeta2.
17486117 2007 The lymphocyte function-associated antigen-1 receptor costimulates plasma membrane Ras via phospholipase D2.
17468108 2007 Mutation of a conserved asparagine in the I-like domain promotes constitutively active integrins alphaLbeta2 and alphaIIbbeta3.
17430469 2007 Role of anti-human leucocyte antigen class II alloantibody and monocytes in development of transfusion-related acute lung injury.
17078873 2006 Dendritic cell-mediated HIV-1 transmission to T cells of LAD-1 patients is impaired due to the defect in LFA-1.
17045822 2006 Activation of leukocyte beta2 integrins by conversion from bent to extended conformations.
17038526 2007 Shear flow-dependent integration of apical and subendothelial chemokines in T-cell transmigration: implications for locomotion and the multistep paradigm.
16963559 2006 AL-57, a ligand-mimetic antibody to integrin LFA-1, reveals chemokine-induced affinity up-regulation in lymphocytes.
16920795 2006 Regulation of outside-in signaling and affinity by the beta2 I domain of integrin alphaLbeta2.
16918410 2006 LFA-1 as a key regulator of immune function: approaches toward the development of LFA-1-based therapeutics.
16855029 2006 Organization of the integrin LFA-1 in nanoclusters regulates its activity.
16705652 2006 Dynamic control of allosteric antagonism of leukocyte function antigen-1 and intercellular adhesion molecule-1 interaction.
16622014 2006 Enhancement of LFA-1-mediated T cell adhesion by human T lymphotropic virus type 1 p12I1.
16505487 2006 Transition from rolling to firm adhesion can be mimicked by extension of integrin alphaLbeta2 in an intermediate affinity state.
16492228 2006 Proinflammatory cytokines, adhesion molecules, and lymphocyte integrin expression in the internal jugular blood of migraine patients without aura assessed ictally.
16472601 2006 The hepatitis C envelope 2 protein inhibits LFA-1-transduced protein kinase C signaling for T-lymphocyte migration.
16301335 2005 Specific integrin alpha and beta chain phosphorylations regulate LFA-1 activation through affinity-dependent and -independent mechanisms.
16249234 2005 Fundamentally different roles for LFA-1, Mac-1 and alpha4-integrin in neutrophil chemotaxis.
16207819 2005 Dynamic partitioning into lipid rafts controls the endo-exocytic cycle of the alphaL/beta2 integrin, LFA-1, during leukocyte chemotaxis.
16100282 2005 I-domain of lymphocyte function-associated antigen-1 mediates rolling of polystyrene particles on ICAM-1 under flow.
16038038 2005 Expression of adhesion molecules on mature cholangiocytes in canal of Hering and bile ductules in wedge biopsy samples of primary biliary cirrhosis.
16037628 2005 Deep venous thrombosis: behaviour of the polymorphonuclear leukocyte integrin pattern at baseline and after in vitro activation.
16002691 2005 Regulation of LFA-1 activity through cytoskeleton remodeling and signaling components modulates the efficiency of HIV type-1 entry in activated CD4+ T lymphocytes.
15983060 2005 A talin-dependent LFA-1 focal zone is formed by rapidly migrating T lymphocytes.
15958383 2005 Epitope mapping of monoclonal antibody to integrin alphaL beta2 hybrid domain suggests different requirements of affinity states for intercellular adhesion molecules (ICAM)-1 and ICAM-3 binding.
15946252 2005 Integrin CD11a cytoplasmic tail interacts with the CD45 membrane-proximal protein tyrosine phosphatase domain 1.
15851656 2005 Distinct role of lymphocyte function-associated antigen-1 in mediating effective cytolytic activity by cytotoxic T lymphocytes.
15834409 2005 Lymphocyte arrest requires instantaneous induction of an extended LFA-1 conformation mediated by endothelium-bound chemokines.
15730520 2005 Haplotype analysis of the CD11 gene cluster in patients with chronic Helicobacter pylori infection and gastric ulcer disease.
15728350 2005 An atomic resolution view of ICAM recognition in a complex between the binding domains of ICAM-3 and integrin alphaLbeta2.
15693793 2005 CD226 is expressed on the megakaryocytic lineage from hematopoietic stem cells/progenitor cells and involved in its polyploidization.
15622747 1997 [Study on the relationship between the expression of adhesion molecules and the invasiveness of acute myeloid leukemia cells].
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15611342 2004 The primacy of affinity over clustering in regulation of adhesiveness of the integrin {alpha}L{beta}2.
15528364 2004 The functional interaction of the beta 2 integrin lymphocyte function-associated antigen-1 with junctional adhesion molecule-A is mediated by the I domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356110 2004 LFA-1 contributes an early signal for NK cell cytotoxicity.
15308572 2004 Ligation of lymphocyte function-associated antigen-1 on monocytes decreases very late antigen-4-mediated adhesion through a reactive oxygen species-dependent pathway.
15240749 2004 Direct quantification of the modulation of interaction between cell- or surface-bound LFA-1 and ICAM-1.
15208262 2004 The importance of virus-associated host ICAM-1 in human immunodeficiency virus type 1 dissemination depends on the cellular context.
15113754 2004 LFA-1 signaling through p44/42 is coupled to perforin degranulation in CD56+CD8+ natural killer cells.
14722085 2004 RanBPM is a phosphoprotein that associates with the plasma membrane and interacts with the integrin LFA-1.
14695458 2004 Increased expression of monocyte CD11a and intracellular adhesion molecule-1 in patients with initial atherosclerotic coronary stenosis.
14688105 2004 Tumor necrosis factor alpha enhances Actinobacillus actinomycetemcomitans leukotoxin-induced HL-60 cell apoptosis by stimulating lymphocyte function-associated antigen 1 expression.
14676297 2003 CD226 (DNAM-1) is involved in lymphocyte function-associated antigen 1 costimulatory signal for naive T cell differentiation and proliferation.
12855590 2003 RUNX/AML and C/EBP factors regulate CD11a integrin expression in myeloid cells through overlapping regulatory elements.
12847234 2003 IL-15-mediated induction of LFA-1 is a late step required for cytotoxic differentiation of human NK cells from CD34+Lin- bone marrow cells.
12845325 2003 RAPL, a Rap1-binding molecule that mediates Rap1-induced adhesion through spatial regulation of LFA-1.
12815062 2003 Lymphocyte function-associated antigen-1-mediated T cell adhesion is impaired by low molecular weight phosphotyrosine phosphatase-dependent inhibition of FAK activity.
12694184 2003 Characterization of ICAM-4 binding to the I domains of the CD11a/CD18 and CD11b/CD18 leukocyte integrins.
12616499 2003 Vav1 transduces TCR signals required for LFA-1 function and cell polarization at the immunological synapse.
12526797 2003 Structures of the alpha L I domain and its complex with ICAM-1 reveal a shape-shifting pathway for integrin regulation.
12516552 2002 Adhesion of dendritic cells derived from CD34+ progenitors to resting human dermal microvascular endothelial cells is down-regulated upon maturation and partially depends on CD11a-CD18, CD11b-CD18 and CD36.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12392323 2002 Immunophenotypic analysis of human spleen compartments.
12368450 2002 Mycobacterium tuberculosis-infected human macrophages exhibit enhanced cellular adhesion with increased expression of LFA-1 and ICAM-1 and reduced expression and/or function of complement receptors, FcgammaRII and the mannose receptor.
12207338 2002 Bacterial fimbriae activate human peripheral blood monocytes utilizing TLR2, CD14 and CD11a/CD18 as cellular receptors.
12202941 2002 The role of LFA-1 in the lysis of bladder cancer cells by bacillus Calmette-Guérin and interleukin 2-activated killer cells.
12171996 2002 The small GTPase Rap1 is required for Mn(2+)- and antibody-induced LFA-1- and VLA-4-mediated cell adhesion.
12163503 2002 Chemokine stimulation of lymphocyte alpha 4 integrin avidity but not of leukocyte function-associated antigen-1 avidity to endothelial ligands under shear flow requires cholesterol membrane rafts.
12163056 2002 N-acetyl-L-cysteine suppresses constitutive expression of CD11a/LFA-1alpha protein in myeloid lineage.
12139949 2002 Alteration in expression of beta 2 integrins on lamina propria lymphocytes in ulcerative colitis and Crohn's disease.
12117984 2002 cag+ Helicobacter pylori induces homotypic aggregation of macrophage-like cells by up-regulation and recruitment of intracellular adhesion molecule 1 to the cell surface.
11953106 2002 [Study of the function of leukocyte adhesion molecules in chronic respiratory diseases].
11929876 2002 Dynamic regulation of LFA-1 activation and neutrophil arrest on intercellular adhesion molecule 1 (ICAM-1) in shear flow.
11882033 2002 Differential expression of beta1 and beta2 integrins and L-selectin on CD4+ and CD8+ T lymphocytes in human blood: comparative analysis between isolated cells, whole blood samples and cryopreserved preparations.
11857637 2002 Inhibition of LFA-1/ICAM-1 and VLA-4/VCAM-1 as a therapeutic approach to inflammation and autoimmune diseases.
11812992 2002 JAM-1 is a ligand of the beta(2) integrin LFA-1 involved in transendothelial migration of leukocytes.
11792712 2002 Activation-induced conformational changes in the I domain region of lymphocyte function-associated antigen 1.
11786177 2001 Synergistic inhibitory activity of alpha- and beta-LFA-1 peptides on LFA-1/ICAM-1 interaction.
11544294 2001 Human endothelial-cell specific molecule-1 binds directly to the integrin CD11a/CD18 (LFA-1) and blocks binding to intercellular adhesion molecule-1.
11353828 2001 Reversibly locking a protein fold in an active conformation with a disulfide bond: integrin alphaL I domains with high affinity and antagonist activity in vivo.
10493852 1999 Structural basis for LFA-1 inhibition upon lovastatin binding to the CD11a I-domain.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
10477596 1999 Selective diapedesis of Th1 cells induced by endothelial cell RANTES.
9789327 1998 Integrins take partners: cross-talk between integrins and other membrane receptors.
9743356 1998 HIV-1 Tat inhibits human natural killer cell function by blocking L-type calcium channels.
9676575 1998 Ligand recognition by the I domain-containing integrins.
8995416 1997 cDNA cloning and chromosomal localization of the human telencephalin and its distinctive interaction with lymphocyte function-associated antigen-1.
8805579 1996 The role of the divalent cation in the structure of the I domain from the CD11a/CD18 integrin.
8103515 1993 Characterization of the CD11a (alpha L, LFA-1 alpha) integrin gene promoter.
8099450 1993 Identification of cell-specific and developmentally regulated nuclear factors that direct myeloid and lymphoid expression of the CD11a gene.
8097887 1993 Description of the leukocyte function-associated antigen 1 (LFA-1 or CD11a) promoter.
7691868 1993 Distribution of cell adhesion molecules on CD56++, CD3-, CD16- large granular lymphocytes and endothelial cells in first-trimester human decidua.
7576051 1995 Ins and outs of LFA-1.
7542116 1995 Differential expression of cell adhesion molecules by human hematopoietic progenitor cells from bone marrow and mobilized adult peripheral blood.
7479767 1995 Crystal structure of the I-domain from the CD11a/CD18 (LFA-1, alpha L beta 2) integrin.
3301632 1987 Differential function of LFA-1 family molecules (CD11 and CD18) in adhesion of human monocytes to melanoma and endothelial cells.
3284962 1988 Chromosomal location of the genes encoding the leukocyte adhesion receptors LFA-1, Mac-1 and p150,95. Identification of a gene cluster involved in cell adhesion.
2894392 1988 Human memory T lymphocytes express increased levels of three cell adhesion molecules (LFA-3, CD2, and LFA-1) and three other molecules (UCHL1, CDw29, and Pgp-1) and have enhanced IFN-gamma production.
2537322 1989 Primary structure of the leukocyte function-associated molecule-1 alpha subunit: an integrin with an embedded domain defining a protein superfamily.
2477710 1989 T-cell receptor cross-linking transiently stimulates adhesiveness through LFA-1.
1762294 1991 Differentially regulated cell surface expression of leukocyte adhesion receptors on neutrophils.
1702722 1990 CD27 expression by a distinct subpopulation of human B lymphocytes.
1448173 1992 Molecular cloning of ICAM-3, a third ligand for LFA-1, constitutively expressed on resting leukocytes.