Property Summary

Ligand Count 126
NCBI Gene PubMed Count 162
PubMed Score 757.34
PubTator Score 1456.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (17)

Disease log2 FC p
psoriasis 1.100 1.8e-06
Astrocytoma, Pilocytic 1.300 4.1e-07
Atopic dermatitis 1.100 2.3e-02
COPD -1.200 6.8e-04
cutaneous lupus erythematosus 3.000 8.8e-05
glioblastoma 1.200 2.4e-02
interstitial cystitis 2.100 3.6e-03
lung cancer -2.200 3.9e-03
lung carcinoma -2.700 4.6e-33
non-small cell lung cancer -1.609 2.9e-16
osteosarcoma -3.401 3.9e-04
pediatric high grade glioma 1.300 6.0e-04
periodontitis 1.300 5.4e-28
primary Sjogren syndrome 1.100 8.6e-03
spina bifida 1.000 3.9e-02
tuberculosis 1.500 1.6e-08
ulcerative colitis 1.800 3.8e-04

PDB (35)

Gene RIF (146)

AA Sequence

MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGAPGEGNSTGSL      1 - 70
YQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCDQNTYLSGLCYLFRQNLQGPM     71 - 140
LQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSD    141 - 210
YVKRKDPDALLKHVKHMLLLTNTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDII    211 - 280
RYIIGIGKHFQTKESQETLHKFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELS    281 - 350
SSGISADLSRGHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLL    351 - 420
ASGAPRYQHMGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLIGAPLFYGEQR    421 - 490
GGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVAVGAPLEEQGAVYIFNGRHGG    491 - 560
LSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVAVGAESQMIVLSSRPVVDMVTLMSFSPAEIP    561 - 630
VHEVECSYSTSNKMKEGVNITICFQIKSLIPQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIA    631 - 700
VTTSMSCTDFSFHFPVCVQDLISPINVSLNFSLWEEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEKN    701 - 770
CGEDKKCEANLRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQ    771 - 840
IPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTCNNEDSDLLED    841 - 910
NSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPS    911 - 980
EGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFS    981 - 1050
LCSSLSISFNSSKHFHLYGSNASLAQVVMKVDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRN   1051 - 1120
LKEKMEAGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSESGGGKD                       1121 - 1170
//

Text Mined References (168)

PMID Year Title