Property Summary

NCBI Gene PubMed Count 51
PubMed Score 39.97
PubTator Score 41.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
oligodendroglioma 1.600 3.5e-03
psoriasis 1.200 2.0e-04
glioblastoma 2.100 7.6e-04
ependymoma 1.600 1.2e-06
cystic fibrosis -1.155 8.9e-05
astrocytoma 1.900 2.5e-02
Hydrolethalus syndrome 1.648 3.2e-02
colon cancer -2.100 2.6e-04
breast carcinoma -2.000 4.1e-03
fibroadenoma -2.400 2.4e-02
diabetes mellitus -1.100 2.2e-03
interstitial cystitis 1.500 3.5e-04
pediatric high grade glioma 1.800 1.2e-04
group 3 medulloblastoma -1.300 1.3e-03
pilocytic astrocytoma 1.700 8.2e-06
non-inflammatory breast cancer -1.900 6.3e-04
ductal carcinoma in situ -3.000 3.9e-04
invasive ductal carcinoma -3.600 1.5e-03

Protein-protein Interaction (9)

Gene RIF (18)

PMID Text
26320193 Data indicate that S100 calcium binding protein P (S100P) increased lung cancer cell migration by binding integrin alpha7.
26076707 Taken together, these results further support the use of a7 integrin as a potential therapy for Duchenne muscular dystrophy
26011651 Data suggest that ITGA7 is an epigenetically regulated tumour suppressor gene and a prognostic factor in human malignant pleural mesothelioma.
24227711 The absence of either alpha7beta1 integrin or alpha6beta1 integrin impairs the ability of Schwann cells to spread and to bind laminin.
24091324 Alpha7beta1D integrin modifies Ca2+ regulatory pathways and offers a means to protect the myocardium from ischemic injury.
23830872 ITGA7 binds to tissue inhibitor of metalloproteinase 3 (TIMP3) in prostate cancer cells.
23800289 Digenic mutational inheritance of the integrin alpha 7 and the myosin heavy chain 7B genes causes congenital myopathy with left ventricular non-compact cardiomyopathy. [ITGA7]
20651226 This report provides a novel insight into the mechanism, involving interaction with high temperature requirement A2, by which ITGA7 acts as a tumor suppressor.
20460506 ILK interaction with MCM7 and MCM7 phosphorylation may be a critical event in ITGA7 signaling pathway, leading to tumor suppression.
20453000 Observational study of gene-disease association. (HuGE Navigator)
19416897 laminin-111 (alpha(1), beta(1), gamma(1)), which is expressed during embryonic development but absent in normal or dystrophic skeletal muscle, increased alpha(7)-integrin expression in mouse and DMD patient myoblasts
18940796 cleavage is a novel mechanism that regulates alpha7 integrin functions in skeletal muscle, and that the generation of such cleavage sites is another evolutionary mechanism for expanding and modifying protein functions.
17641293 Alpha7B is a novel marker of the contractile phenotype, and alpha7 expression is essential for human airway smooth muscle cell maturation, which is a laminin-dependent process.
17618648 analysis of how distinct acidic clusters and hydrophobic residues in the alternative splice domains X1 and X2 of alpha7 integrins define specificity for laminin isoforms
17551147 Integrin alpha7 mutations are associated with prostate cancer, liver cancer, glioblastoma multiforme, and leiomyosarcoma
17054947 alpha7-expressing fetal myoblasts are capable of differentiation to osteoblast lineage with a coordinated switch in integrin profiles and may represent a mechanism that promotes homing and recruitment of myogenic stem cells for tissue remodeling.
15117962 FHL2 and FHL3, respectively, are colocalized with alpha(7)beta(1) integrin receptor at the periphery of Z-discs, suggesting a role in mechanical stabilization of muscle cells
12057917 conclude that secondary integrin alpha 7 deficiency is rather common in muscular dystrophy/myopathy of unknown etiology

AA Sequence

MAGARSRDPWGASGICYLFGSLLVELLFSRAVAFNLDVMGALRKEGEPGSLFGFSVALHRQLQPRPQSWL      1 - 70
LVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTC     71 - 140
AHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCEGRPQGHEQFGFCQQGTAAAFSPDSH    141 - 210
YLLFGAPGTYNWKGTARVELCAQGSADLAHLDDGPYEAGGEKEQDPRLIPVPANSYFGLLFVTNIDSSDP    211 - 280
DQLVYKTLDPADRLPGPAGDLALNSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKDSASRLV    281 - 350
PEVMLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVYVYLNQGGHWAGISPLRLCGS    351 - 420
PDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLGVVAKPSQVLEGEAVGIKSFGYSLSGS    421 - 490
LDMDGNQYPDLLVGSLADTAVLFRARPILHVSHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPS    491 - 560
SYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQLQENVKDKL    561 - 630
RAIVVTLSYSLQTPRLRRQAPGQGLPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVRARFCT    631 - 700
RVSDTEFQPLPMDVDGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVMLPDSLHYSGV    701 - 770
RALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETTELEVELLLATISEQELHPVS    771 - 840
ARARVFIELPLSIAGMAIPQQLFFSGVVRGERAMQSERDVGSKVKYEVTVSNQGQSLRTLGSAFLNIMWP    841 - 910
HEIANGKWLLYPMQVELEGGQGPGQKGLCSPRPNILHLDVDSRDRRRRELEPPEQQEPGERQEPSMSWWP    911 - 980
VSSAEKKKNITLDCARGTANCVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKS    981 - 1050
SIKNLMLRDASTVIPVMVYLDPMAVVAEGVPWWVILLAVLAGLLVLALLVLLLWKMGFFKRAKHPEATVP   1051 - 1120
QYHAVKIPREDRQQFKEEKTGTILRNNWGSPRREGPDAHPILAADGHPELGPDGHPGPGTA            1121 - 1181
//

Text Mined References (53)

PMID Year Title
26320193 2015 S100P interacts with integrin ?7 and increases cancer cell migration and invasion in lung cancer.
26076707 2015 Human ?7 Integrin Gene (ITGA7) Delivered by Adeno-Associated Virus Extends Survival of Severely Affected Dystrophin/Utrophin-Deficient Mice.
26011651 2015 Epigenetic down-regulation of integrin ?7 increases migratory potential and confers poor prognosis in malignant pleural mesothelioma.
24227711 2013 ?6?1 and ?7?1 integrins are required in Schwann cells to sort axons.
24091324 2013 Integrins protect cardiomyocytes from ischemia/reperfusion injury.
23830872 2013 Integrin ?7 binds tissue inhibitor of metalloproteinase 3 to suppress growth of prostate cancer cells.
23800289 2013 Digenic mutational inheritance of the integrin alpha 7 and the myosin heavy chain 7B genes causes congenital myopathy with left ventricular non-compact cardiomyopathy.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
22779914 2012 Biophysical and structural studies of the human calcium- and integrin-binding protein family: understanding their functional similarities and differences.
20651226 2010 Integrin alpha 7 interacts with high temperature requirement A2 (HtrA2) to induce prostate cancer cell death.
20563599 2010 Integrin expression and integrin-mediated adhesion in vitro of human multipotent stromal cells (MSCs) to endothelial cells from various blood vessels.
20460506 2010 Interaction of integrin-linked kinase and miniature chromosome maintenance 7-mediating integrin {alpha}7 induced cell growth suppression.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
19416897 2009 Laminin-111 protein therapy prevents muscle disease in the mdx mouse model for Duchenne muscular dystrophy.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18940796 2008 Genetically determined proteolytic cleavage modulates alpha7beta1 integrin function.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17641293 2007 Laminin-binding integrin alpha7 is required for contractile phenotype expression by human airway myocytes.
17618648 2007 Distinct acidic clusters and hydrophobic residues in the alternative splice domains X1 and X2 of alpha7 integrins define specificity for laminin isoforms.
17551147 2007 Analysis of integrin alpha7 mutations in prostate cancer, liver cancer, glioblastoma multiforme, and leiomyosarcoma.
17054947 2006 alpha7 integrin expressing human fetal myogenic progenitors have stem cell-like properties and are capable of osteogenic differentiation.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15117962 2004 The LIM-only proteins FHL2 and FHL3 interact with alpha- and beta-subunits of the muscle alpha7beta1 integrin receptor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12941630 2003 The muscle integrin binding protein (MIBP) interacts with alpha7beta1 integrin and regulates cell adhesion and laminin matrix deposition.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12057917 2002 Integrin alpha 7 beta 1 in muscular dystrophy/myopathy of unknown etiology.
11884516 2002 Association of the tetraspanin CD151 with the laminin-binding integrins alpha3beta1, alpha6beta1, alpha6beta4 and alpha7beta1 in cells in culture and in vivo.
11361006 2001 Transfection of MCF-7 carcinoma cells with human integrin alpha7 cDNA promotes adhesion to laminin.
11054877 2000 Integrins as receptors for laminins.
10910772 2000 Laminin and alpha7beta1 integrin regulate agrin-induced clustering of acetylcholine receptors.
10906324 2000 The LIM-only protein DRAL/FHL2 binds to the cytoplasmic domain of several alpha and beta integrin chains and is recruited to adhesion complexes.
10694445 2000 The role of extracellular and cytoplasmic splice domains of alpha7-integrin in cell adhesion and migration on laminins.
10459022 1999 Role of transmembrane 4 superfamily (TM4SF) proteins CD9 and CD81 in muscle cell fusion and myotube maintenance.
10403775 1999 Structure, genetic localization, and identification of the cardiac and skeletal muscle transcripts of the human integrin alpha7 gene (ITGA7).
9590299 1998 Mutations in the integrin alpha7 gene cause congenital myopathy.
9570924 1998 Interaction of integrin alpha 7 beta 1 in C2C12 myotubes and in solution with laminin.
9473524 1998 A novel extracellular domain variant of the human integrin alpha 7 subunit generated by alternative intron splicing.
9402008 1997 Alternatively spliced variants: a new view of the integrin cytoplasmic domain.
9354797 1997 Absence of integrin alpha 7 causes a novel form of muscular dystrophy.
9352853 1997 Relation between integrin alpha7Bbeta1 expression in human intestinal cells and enterocytic differentiation.
9307969 1997 The laminin-binding activity of the alpha 7 integrin receptor is defined by developmentally regulated splicing in the extracellular domain.
8626012 1996 Synaptic integrins in developing, adult, and mutant muscle: selective association of alpha1, alpha7A, and alpha7B integrins with the neuromuscular junction.
8253814 1993 Alternative extracellular and cytoplasmic domains of the integrin alpha 7 subunit are differentially expressed during development.
8126096 1993 Expression of alpha 7 integrin cytoplasmic domains during skeletal muscle development: alternate forms, conformational change, and homologies with serine/threonine kinases and tyrosine phosphatases.
7607681 1995 Localization of the alpha 7 integrin gene (ITGA7) on human chromosome 12q13: clustering of integrin and Hox genes implies parallel evolution of these gene families.
1839357 1991 Laminin-binding integrin alpha 7 beta 1: functional characterization and expression in normal and malignant melanocytes.
1315319 1992 H36-alpha 7 is a novel integrin alpha chain that is developmentally regulated during skeletal myogenesis.