1. Home
  2. Targets
  3. Integrin alpha-6

Tchem Integrin alpha-6

Integrin alpha-6/beta-1 is a receptor for laminin on platelets. Integrin alpha-6/beta-4 is a receptor for laminin in epithelial cells and it plays a critical structural role in the hemidesmosome (By similarity). ITGA6:ITGB4 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling (PubMed:20682778). ITGA6:ITGB4 binds to IGF1 and this binding is essential for IGF1 signaling (PubMed:22351760).

The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 6 subunit. This subunit may associate with a beta 1 or beta 4 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. The alpha 6 beta 4 integrin may promote tumorigenesis, while the alpha 6 beta 1 integrin may negatively regulate erbB2/HER2 signaling. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]

 Comments

Property Summary

NCBI Gene PubMed Count 223
PubMed Score 168.82
PubTator Score 210.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 2.0
Disease Target Count Z-score Confidence
Epidermolysis bullosa 21 5.146 2.6
Disease Target Count Z-score Confidence
Cancer 2346 4.156 2.1
Bullous pemphigoid 17 3.037 1.5

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -1.500 6.4e-05
Barrett's esophagus 1.700 9.2e-03
esophageal adenocarcinoma 1.400 4.3e-02
osteosarcoma 2.203 3.1e-03
ependymoma 1.600 7.6e-06
cystic fibrosis 4.377 6.1e-08
atypical teratoid / rhabdoid tumor 1.600 2.3e-03
glioblastoma 1.300 5.7e-03
medulloblastoma, large-cell -1.900 5.1e-03
Duchenne muscular dystrophy 1.033 1.9e-05
juvenile dermatomyositis 1.155 3.4e-08
tuberculosis 1.100 3.3e-03
non-small cell lung cancer 1.074 7.6e-04
Common variable immunodeficiency -1.407 4.3e-03
intraductal papillary-mucinous carcinoma... 1.100 8.0e-03
intraductal papillary-mucinous neoplasm ... 2.000 2.7e-03
lung cancer 1.200 2.4e-04
group 4 medulloblastoma -1.100 4.6e-02
lung adenocarcinoma -1.100 5.8e-05
Breast cancer -1.500 1.7e-05
lung carcinoma -1.200 1.3e-05
dermatomyositis 1.100 4.7e-03

Synonym

Accession P23229 B2RMU9 B4DG69 B4DKB8 C4AM96 G5E9H1 Q08443 Q0MRC7 Q14646 Q16508 Q53RX7 Q59HB7 Q86VL6 Q9UCT1 Q9UN03
Symbols CD49f
VLA-6
ITGA6B

Gene

ITGA6

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

 UniProt Keyword (22)

See all...

 GO Function (2)

 GO Component (10)

 GO Process (27)

See all...

 Compartment GO Term (43)

See all...

 MGI Phenotype (17)

See all...

 GWAS Trait (2)

 HCA RNA Cell Line (56)

See all...

 CSPA Cell Line (30)

See all...

Pathway (42)

See all...

Protein-protein Interaction (15)

LAMA5   ITGB1   LAMB1   LAMC1   ITGB4   LAMA2   LAMA1   LAMB2   DST   LAMB3   LAMC2   PLEC   LAMA4   LAMA3   COL17A1  

Ligand (1)

Structure of CHEMBL3621354

CHEMBL3621354
pKi 6.77

Gene RIF (151)

PMID Text
27001172 HIF-dependent regulation of ITGA6 is one mechanism by which sorting for CD49f (+) cells enhances cancer stem cells.
26674523 Genetic and Immunohistochemical Expression of Integrins ITGAV, ITGA6, and ITGA3 As Prognostic Factor for Colorectal Cancer
26381405 integrin alpha6beta4 stimulates invasion by promoting autocrine EGFR signaling through transcriptional up-regulation of key EGFR family members and by facilitating HGF-stimulated EGFR ligand secretion
26350464 syndecans remain anchored to the alpha6beta4 integrin via its cytoplasmic domain, but the activation of cell motility is disrupted
26239765 Schwann cells in the tumor-nerve environment affect tumor cell migration and invasion through regulation of the laminin receptor A6B1 and its variant A6pB1.
26108791 We here identify CD49f and CD34 as markers to permit selection of the stem/progenitor cell-like population from human myometrium
26013602 CD49f is a marker of bone marrow mesenchymal stem cells and is correlated with changes in these stem cells under inflammatory conditions.
25858144 our observations suggest that miR-25 is a key regulator of invasiveness in human prostate cancer through its direct interactions with av- and a6-integrin expression
25825984 Amphiregulin enhances alpha6beta1 integrin expression and cell motility in human chondrosarcoma cells through Ras/Raf/MEK/ERK/AP-1 pathway.
25561492 Integrin alpha6B-beta1 preferentially binds laminin 511 and this ligand-integrin ligation induces the TAZ nuclear localization and transcriptional activity.
25472585 ITGA3, ITGA6, ITGB3,ITGB4 and ITGB5 are associated with GC susceptibility (rs2675), ITGA3, ITGA6, ITGB3, ITGB4 and ITGB5 are associated with gastric cancer susceptibility tumor stage and lymphatic metastasis in Chinese Han population.
25450398 Inhibition of actin, FAK, and ILK expression resulted in significantly increased uPAR expression and the variant ITGA6p production in aggressive prostate and breast cancer cell lines.
25318615 Unique sites of interaction between alphavbeta6 and uPAR are most likely located in uPAR domains II and III.
25288800 Data indicate that integrin alpha6 repression by Kruppel-like factor-9 (KLF9) inhibits glioblastoma cell stemness and tumorigenicity.
24982892 PIK3R3, ITGB1, ITGAL, and ITGA6, were involved in the regulation of actin cytoskeleton that link to triple-negative breast cancer migration.
24955499 Role of N-terminal residues in Abeta interactions with integrin receptor and cell surface
24860089 NLGN1 and alpha6 integrin preferentially colocalize in the mature retinal vessels, whereas NLGN1 deletion causes an aberrant VE-cadherin, laminin and alpha6 integrin distribution in vessels
24802970 Primary osteosarcoma patient tumor cell populations expressing high levels of CD49f and low levels of CD90 produce an aggressive xenograft tumor in mice.
24739392 These data suggest that systemic targeting of the ITGA6-dependent function of established tumors in bone may offer a noncytotoxic approach to arrest the osteolytic progression of metastatic prostate cancer.
24681327 These results indicate that mAbs to the laminin a4 globular domain are able to inhibit tumor cell adhesion and migration on laminins 411 and 421, and that alpha6beta1 integrin and MCAM bind a4-laminins at very close sites on the globular domain
24564203 The data presented herein clearly show that down regulation of ITGA6 gene in the human thymic epithelium triggers a complex cascade of effects upon the expression levels of several other cell migration-related genes.
24418536 Cellular integrin alpha6beta4 complex is necessary for HPV16 infection in HaCaTs cells.
24403311 Integrin alpha6A splice variant regulates proliferation and the Wnt/beta-catenin pathway in human colorectal cancer cells.
24375374 Expression of alpha2-integrin and EZH2 in a small fraction of prostate cancer cells is supportive for their role as stem cell marker. alpha6-integrin was predictive for prostate cancer biochemical and local recurrence, and disease specific death.
24304619 Knockdown integrin alpha6 can inhibit the proliferation and metastasis of hepatocellular carcinoma cells.
24289209 Integrin alpha6beta4 contributes to the suppression of anoikis in a primarily alpha6 subunit-dependent manner in undifferentiated cells.
24227711 The integrins, alpha6beta1 (and alpha7beta1) are the laminin-binding integrins required for axonal sorting.
24180592 alpha6beta4 integrin and c-Src activation is important early signaling events to lead mTOR activation and cap-dependent translation of VEGF.
24056178 the alpha6 integrin subunit in Bone marrow-derived mesenchymal stem cells is important for their ability to stimulate vessel morphogenesis.
24042193 High ITGA6 expression is associated with esophageal squamous cell carcinoma.
24022922 alpha6-integrin is required for hemangioma stem cellsadherence to laminin, vessel formation in vivo, and for homing to the liver.
24015244 CD49f expressing cells from newly-dissected gastric cancers form tumors with histological features similar to the parent tumor.
23708747 These findings demonstrated that CD49f is an important marker for identifying colorectal colon cancer-initiating cells(CSCs) and suggest that the CD49f cell fraction may be the best candidate for colorectal CSCs.
23611113 Necl-4 interacts in cis with integrin alpha6 beta4 through their extracellular regions and Necl-4 inhibited the phorbol ester-induced disassembly of hemidesmosomes
23499737 Integrin alpha6 promoter activity was elevated by 2.5-fold in PTHrP (Parathyroid hormone-related protein)-overexpressing vs. control PC-3 cells.
23496044 A report on the broad spectrum of clinical and morphological epidermolysis bullosa manifestations associated with novel alpha6beta4 integrin mutations.
23436775 GLI1 regulates the neuropilin-2/alpha6beta1 integrin based autocrine pathway that contributes to breast cancer initiation.
23333304 HIV-1 Vif downregulates the expression of integrin, alpha 6 (ITGA6) in Vif-expression T cells
23306848 Overexpression of integrin alpha6 is associated with a migratory and invasive phenotype of intrahepatic cholangiocarcinoma.
23233446 Data indicate that long-term self-renewing leukemic stem cells reside within the CD34(+)/ITGA6(+) fraction.
23106339 S-nitrosylation of ITGalpha6 increased the extent of prostate cancer cell migration, which could be a potential mechanism of NO- and iNOS-induced enhancement of prostate cancer metastasis.
23071686 CD49f is an efficient marker of monolayer- and spheroid colony-forming cells of the benign and malignant human prostate.
23071680 Data indicate that resistance to UVB induced apoptosis in the alpha6 integrin(high+)/CD44(+) cells involved increased expression of TAp63 and was overcome by PI-3 kinase inhibition.
23070965 Interaction between alpha6 integrin and E-cadherin drives liver metastasis of colorectal cancer cells through hepatic angiopoietin-like 6.
23045288 the CD49f(-)CD133(+) phenotype appears to identify OSIC-like cells that possess strong tumorigenicity correlated with an impaired osteogenic fate.
22843693 CD151 links alpha(3)beta(1)/alpha(6)beta(1) integrins to Ras, Rac1, and Cdc42 by promoting the formation of multimolecular complexes in the membrane, which leads to the up-regulation of adhesion-dependent small GTPase activation
22684562 Taken together, it was concluded that CD151 promotes the proliferation and migration of PC3 cells through the formation of CD151-integrin complex and the activation of phosphorylated ERK.
22592262 This study identifies modulation of ITGA6 during cell-free varicella-zoster virus (VZV) infection, and provides the first evidence linking ITGA6 with post-entry productive VZV gene expression.
22514625 Epcam+CD44-CD49fHi (non-sphere-forming) basal cells with significantly increased tubule induction activity compared to Epcam+CD44-CD49fLo (true) luminal cells.
22493440 data indicate that the alpha6beta4 integrin is a master regulator of transcription and translation of other integrin subunits and underscore its pivotal role in wound healing and cancer
22396498 The findings indicated that integrin a6b1 promotes the survival of brain endothelial cells by inhibiting prodeath signaling by TNF-R1, in part by inducing cellular FLICE inhibitory protein expression.
22389315 P-cadherin is coexpressed with CD44 and CD49f and mediates stem cell properties in basal-like breast cancer.
22328509 CD151 support of alpha6 random defined diffusion is specific and functionally relevant, and probably underlies diverse CD151 functions in skin, kidney and cancer cells.
22311737 CD49f enhances multipotency and maintains stemness through the direct regulation of OCT4 and SOX2.
22295105 increased expression of ITGA6 is associated with drug-resistance and increased cell adhesion
22049212 signaling from integrin alpha6beta4 facilitates lysophosphatidic acid- stimulated chemotaxis through preferential activation of RhoA, which, in turn, facilitates activation of Rac1
21969027 Junctional epidermolysis bullosa with pyloric atresia (JEB-PA) is a rare autosomal recessive disease with blister formation within the lamina lucida due to mutations in the integrin beta4 (ITGB4) and alpha6 (ITGA6) genes
21799154 The alpha6beta1 integrin is a netrin-4 receptor in endothelial cells.
21752283 Integrin subunits alpha5 and alpha6 regulate cell cycle by modulating the chk1 and Rb/E2F pathways to affect breast cancer metastasis.
21558389 PHLDA1 expression marks the putative epithelial stem cells, downregulates ITGA2 and ITGA6, and contributes to intestinal tumorigenesis
21518455 A physiologic role for PMP22 on the expression of alpha6 integrin.
21474814 in endothelial cells, ligation of alpha2beta1 and alpha6beta1 integrins induces the Notch pathway, and we disclose a novel role of basement membrane proteins in the processes controlling tip vs stalk cell selection
21388972 curcumin inhibits alpha6beta4 signaling and functions by altering intracellular localization of alpha6beta4, thus preventing its association with signaling receptors such as EGFR.
21359644 Data suggest that integrin alpha6beta1 is an important cell surface receptor that mediates the adhesion of the SMMC-7721 hepatocellular carcinoma cell line to type IV collagen.
21195710 Data suggest that the alpha5 laminins emerge as putative primary extracellular matrix mediators of melanoma invasion and metastasis via alpha3/alpha6beta1 and other integrin receptors.
21182210 Mouse models have shown a role for ITGA6 in many developmental processes including cortical and retinal lamination, apical ectodermal ridge formation and organogenesis
21115897 High Integrin alpha6beta4 is associated with anaplastic thyroid carcinoma.
20927591 CD151, c-Met, and integrin alpha3/alpha6 were all overexpressed in pancreatic ductal adenocarcinoma. CD151 and c-Met might be new molecular markers to predict the prognosis of pancreatic ductal adenocarcinoma patients.
20878950 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20855525 Data describe how alpha6beta4 integrin selectively activates Fyn in response to receptor engagement, and show that both catalytic and noncatalytic functions of SHP2 are required for Fyn activation by alpha6beta4.
20695903 Data show that integrin alpha(6)beta(4) interacts with ErbB3 but not with ErbB1, ErbB2 or ErbB4, and enhances the heregulin-induced, ErbB3/ErbB2 heterodimer-mediated DNA synthesis, but not cell motility, in A549 cells.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20564319 Meta-analysis of gene-disease association. (HuGE Navigator)
20508204 Demonstrate a major role of alpha6 integrin in the proangiogenic properties of endothelial progenitor cells.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20452317 Glioblastoma stem cell express high levels of integrin alpha6.
20441998 These data demonstrate that infection requires the binding of human papillomavirus type 16 viral particles to heparan sulfate followed by activation of focal adhesion kinase through integrin alpha 6.
20432448 Laminins and their integrin receptors are necessary for the development and maintenance of the peripheral nervous system, indicating the potential role for integrin receptors in directing prostate tumor cell invasion on nerves during perineural invasion.
19827952 TGF-beta-mediated up-regulation of the expression of the integrin subunits alpha(2) and alpha(6) is mainly mediated in MSC by Smad2.
19808905 These studies define a novel mechanism by which integrin alpha6beta4 promotes cancer cell motility and invasion, and provides insight into how S100A4 expression is regulated in cancer cells.
19775453 Integrin alpha6beta1 co-localizes and interacts with HAb18G/CD147 to mediate tumor invasion and metastatic processes.
19767753 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19586553 the alpha6Bbeta4 integrin inhibits colon cancer cell proliferation and c-Myc activity and is significantly down-regulated in colon cancer cells relative to its alpha6Abeta4 counterpart
19579970 Results assess uterine receptivity in women with unexplained infertility using beta1 integrin molecules VLA-4, -5, and -6 within endometrial tissue in comparison with fertile women.
19491258 results suggest that alpha(6) integrin cleavage permits extravasation of human prostate cancer cells from circulation to bone and can be manipulated to prevent metastasis
19138983 Curcumin inhibits breast cancer cell motility and invasion by directly inhibiting the function of alpha(6)beta(4) integrin, and suggest that curcumin can serve as an effective therapeutic agent in tumors that overexpress alpha(6)beta(4).
19130304 alpha 3, alpha 6A, and beta 1 integrin expression in cancer cells at the invasive front are related to the mode of invasion and prognosis in oral squamous cell carcinoma
19124484 Integrin alpha6beta4 and NET1 coexpression is independently associated with the development of distant metastasis in breast cancer.
19107504 differential expression of the alpha6 subunits is involved in the intestinal epithelial cell renewal process.
18974120 results identify Y1494 as a major regulatory site for signaling from the alpha6beta4 integrin to promote tumor development and progression
18971471 Integrin alpha6beta4 plays an essential role in axonal regeneration and subsequent myelination.
18958175 Tumor cells within the bone expressing the integrin mutation prevented cancer induced spontaneous flinching, tactile allodynia, and movement evoked pain.
18842099 Blockade of the alpha6-integrin enhanced bone marrow (BM) homing of human and nonhuman primate BM-derived hematopoietic stem/progenitor cells.
18831072 CD49f is commonly overexpressed in p-B-ALL, and represents a potentially useful marker for the immunophenotypic detection of MRD.
18818395 PODXL(hi)/CD49f(hi) MSCs were less prone to produce lethal pulmonary emboli
18814027 alpha6beta4 integrin-FAK-p38MAPK pathway is invloved in modulation of LDH expression.
18687805 Extracellular Cyr61 interacts with alpha(5), alpha(6), and beta(1) integrins
18614994 LPS or peritoneal dialysis effluent stimulated the adherence of T cells to mesothelial cells, a process mediated by the integrins alpha6beta1 and alpha4beta1
18550570 Observational study of gene-disease association. (HuGE Navigator)
18451146 CD151-alpha(6) integrin complexes play a functional role in basal-like mammary tumor progression.
18436868 Subepicardial localization of CD117-positive cells and expression of laminin-1 and alpha(6) integrin subunits may all correspond to the activation of regeneration involving an epithelial-mesenchymal transition in adult heart
18270579 the alpha6beta4 integrin strongly influence Akt phosphorylation through ErbB-3 protein regulation
18155160 These results indicate that the alpha(6)(bri)/CD71(dim) subpopulation enriched corneal epithelial stem cells.
17979890 VEGFR2 up-regulation had no effect on VEGF-induced cell proliferation, but significantly enhanced endothelial progenitor cells migration and pseudotubes formation dependent on integrin alpha(6) subunit overexpression.
17935134 alpha-6 integrin is required for the growth and survival of breast cancer cells
17652716 Laminin repressed transcription, directed by the alpha6 gene promoter, by altering the nuclear levels of Sp1 and Sp3
17475774 Integrin-mediated adhesion via alpha3beta1, but not alpha6beta4 integrin, supports cell survival through EGFR by signaling downstream to Erk.
17332515 Keratinocytes expressing elevated levels of alpha6 integrin expanded over 200-fold during the 33-week in vivo study.
17303120 These data taken together suggest that the uPA-mediated cell surface cleavage of the alpha6 integrin extracellular domain is involved in tumor cell invasion and migration on laminin.
17085437 alpha6 integrin might play a role in vascular endothelial growth factor (VEGF)-induced angiogenesis.
16973601 The role of integrin alpha6beta4 in keratinocyte migration via laminin-332 matrix organization is reported.[integrin alpha6beta4; laminin-332]
16965770 The role of PTHrP in breast cancer growth and metastasis may be mediated via upregulation of integrin alpha6beta4 expression and Akt activation, with consequent inactivation of GSK-3.
16940506 in natural HPV infection, proliferating keratinocytes expressing alpha6 integrin at the site of epithelial wounding might be targeted by virions adsorbed transiently to LN5 secreted by migrating keratinocytes
16870608 Ln-5 is an important regulator of ADPKD cell proliferation and cystogenesis; Ln-5 gamma(2) chain and Ln-5-alpha(6)beta(4) integrin interaction both contribute to these phenotypic changes
16732726 Acquisition of multiple antitumor drugs was accompanied by a drastically reduced expression of alpha6beta1 in the adenocarcinoma cells.
16571677 Both integrin alpha3beta1- and alpha6beta4-dependent cell adhesion to laminin-5 were also impaired in CD151-silenced cells.
16537545 EWI proteins EWI-2 and EWI-F, alpha3beta1 and alpha6beta4 integrins, and protein palmitoylation have contrasting effects on cell surface CD9 organization
16504015 IL-1alpha can induce selective upregulation of alpha6beta1-integrin and uPA/uPAR in pancreatic cancer cells and these changes may modulate the aggressive functions of pancreatic cancer.
16436605 PMP22 forms a complex with alpha6beta4 integrin in cultured colonic adenocarcinoma cells.
16424229 A peptide is identified within the extracellular domain of integrin alpha 6 molecule, to which antibodies in the sera from patients with oral pemphigoid (OP) bind, and which may play an important role in the pathogenesis of OP.
16339173 Data show that alpha6 and alpha3 integrin subunits interact with laminin 5 to increase expression of E-cadherin, and suggest that phosphoinositide 3-kinase (PI 3-kinase) activation plays a key role in this cross-talk.
16258729 alpha6beta4 integrin is mobilized and activated durign carcinoma progression [review]
16228294 the signals induced by integrin alpha6beta1 modulate at the level of PI3K and Cdc42 activity to allow platelets to actively form filopodia
15983209 alpha3, alpha5, and alpha6 beta1 integrins are expressed in ductal cells at 8 weeks, before glucagon- and insulin-immunoreactive cells bud off in fetal pancrea.
15897878 alpha6beta4 integrin potentiates autotaxin expression through the upregulation and activation of NFAT1.
15885076 adhesion to laminin-1 through alpha6-integrin represents a protective mechanism for melanocytes to withstand UVB damage
15679046 Enhanced expression of Integrin alpha6 is associated with liver metastases from gastrointestinal tumours
15579904 alpha6beta4 can augment cell-cell adhesion and slow down haptotaxis over laminin-5
15557282 CD82 attenuates integrin alpha6 signaling during a cellular morphogenic process
15302884 cAMP-Epac-Rap1 pathway regulates cell spreading and cell adhesion to laminin-5 through the alpha3beta1 integrin but not the alpha6beta4 integrin
15194479 Results suggest that bacterial heat shock protein 60 may promote epithelial cell migration through activation of epidermal growth factor receptor and mitogen-activated protein kinases, and inhibition of alpha6beta4 integrin expression.
15161909 alpha(6)beta(4) has a generic influence on the invasion of carcinoma cells that is not specific to Met
14707725 Results indicate that alpha6-containing integrin expression can be a significant marker of malignancy in intraductal papillary-mucinous tumors (IPMTs).
14607975 ligand-binding specificities of integrin alpha3beta1 and alpha6beta1
14602071 Data demonstrate that alpha6beta4 integrin mediates pancreatic epithelial cell adhesion to Netrin-1, whereas recruitment of alpha6beta4 and alpha3beta1 regulate the migration of putative pancreatic progenitors on Netrin-1.
14517202 compartmentalization in lipid rafts is necessary to couple the alpha6beta4 integrin to a palmitoylated src family kinases and promote EGF-dependent mitogenesis.
12931024 In pancreatic cancer, IL-1alpha enhanced alpha(6)beta(1)-integrin expression, probably via increased IL-1RI levels.
12919677 Data show that macrophage stimulating protein (MSP) and its receptor (Ron) induce phosphorylation of both Ron and alpha6beta4 integrin, and result in activation of alpha3beta1 integrin.
12909644 alpha6beta1 integrins have roles as thrombospondin receptors in microvascular and large vessel endothelial cells
12826661 integrin alpha 6 beta 1 binds to CCN1
12499048 Results suggest that alpha6beta4 integrin-mediated interactions of astrocytes with beta(ig)-h3 transduce intracellular signals through the focal adhesion proteins, which may regulate certain aspects of astrocyte response to brain injury.
12429829 Data suggest that the stability of the interaction between alpha6beta4 and laminin-5 is influenced by the clustering of alpha6beta4 through the deposition of laminin-5 underneath the cells.
12364323 role in mediating pro-angiogenic activity of CYR61
12105188 Integrin (alpha 6 beta 4) regulation of eIF-4E activity and VEGF translation (Integrin alpha6beta4)
11988844 Human prostate tumors display on their cell surface the alpha6beta1 and/or alpha3beta1 integrins
11959811 Production of the alpha(6p) variant from alpha(6) integrin may involve a post-translational processing event at the cell surface.
11861761 These results demonstrate that integrin-dependent cell to extracellular matrix adhesion reinforces E-cadherin-dependent cell-cell adhesion in Caco-2 cells.
11852236 The PDZ domain of TIP-2/GIPC interacts with the C-terminus of the integrin alpha5 and alpha6 subunits.
11809527 Reduction in integrin alpha6beta4 is related to changes seen during immortalization and malignant progression
11728829 Mechanisms involved in alpha6beta1-integrin-mediated Ca(2+) signalling
10713718 HIV-1 Vif downregulates the expression of integrin, alpha 6 (ITGA6) in Vif-expression T cells

AA Sequence 

MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAE      1 - 70
ALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRYEKRQH     71 - 140
VNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLRGHEKFGSCQQGVAATFTKDFHYIVFGAPGT    141 - 210
YNWKGIVRVEQKNNTFFDMNIFEDGPYEVGGETEHDESLVPVPANSYLGLLFLTSVSYTDPDQFVYKTRP    211 - 280
PREQPDTFPDVMMNSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEG    281 - 350
LASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGRWNNVKPIRLNGTKDSMFGIAV    351 - 420
KNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVA    421 - 490
VGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGT    491 - 560
LEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEP    561 - 630
SSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGV    631 - 700
PELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFPEKQLSCVANQN    701 - 770
GSQADCELGNPFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSG    771 - 840
VAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLGKPLTNLGTATLNIQWPKEISNGKWLLYLVKV    841 - 910
ESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPL    911 - 980
RGLDSKASLILRSRLWNSTFLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYS    981 - 1050
GVPWWIILVAILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQWI   1051 - 1120
TKWNENESYS                                                               1121 - 1130
//

Text Mined References (232)

PMID Year Title
27001172 2016 ITGA6 is directly regulated by hypoxia-inducible factors and enriches for cancer stem cell activity and invasion in metastatic breast cancer models.
26674523 2015 Genetic and Immunohistochemical Expression of Integrins ITGAV, ITGA6, and ITGA3 As Prognostic Factor for Colorectal Cancer: Models for Global and Disease-Free Survival.
26381405 2015 Integrin ?6?4 Promotes Autocrine Epidermal Growth Factor Receptor (EGFR) Signaling to Stimulate Migration and Invasion toward Hepatocyte Growth Factor (HGF).
26350464 2015 Syndecan-1 and Syndecan-4 Capture Epidermal Growth Factor Receptor Family Members and the ?3?1 Integrin Via Binding Sites in Their Ectodomains: NOVEL SYNSTATINS PREVENT KINASE CAPTURE AND INHIBIT ?6?4-INTEGRIN-DEPENDENT EPITHELIAL CELL MOTILITY.
26239765 2016 Schwann Cells Increase Prostate and Pancreatic Tumor Cell Invasion Using Laminin Binding A6 Integrin.
26121317 2015 Clinical significance of the integrin ?6?4 in human malignancies.
26108791 2015 CD34 and CD49f Double-Positive and Lineage Marker-Negative Cells Isolated from Human Myometrium Exhibit Stem Cell-Like Properties Involved in Pregnancy-Induced Uterine Remodeling.
26013602 2015 CD49f Acts as an Inflammation Sensor to Regulate Differentiation, Adhesion, and Migration of Human Mesenchymal Stem Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25911094 2015 Odontogenic Ameloblast-associated Protein (ODAM) Mediates Junctional Epithelium Attachment to Teeth via Integrin-ODAM-Rho Guanine Nucleotide Exchange Factor 5 (ARHGEF5)-RhoA Signaling.
25858144 2015 miR-25 Modulates Invasiveness and Dissemination of Human Prostate Cancer Cells via Regulation of ?v- and ?6-Integrin Expression.
25825984 2015 Amphiregulin enhances alpha6beta1 integrin expression and cell motility in human chondrosarcoma cells through Ras/Raf/MEK/ERK/AP-1 pathway.
25808196 2015 Intensified antineoplastic effect by combining an HDAC-inhibitor, an mTOR-inhibitor and low dosed interferon alpha in prostate cancer cells.
25561492 2015 A laminin 511 matrix is regulated by TAZ and functions as the ligand for the ?6B?1 integrin to sustain breast cancer stem cells.
25472585 2015 Association between polymorphisms of microRNA-binding sites in integrin genes and gastric cancer in Chinese Han population.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25450398 2014 Intracellular modifiers of integrin alpha 6p production in aggressive prostate and breast cancer cell lines.
25318615 2014 Characterization of the interaction between heterodimeric ?v?6 integrin and urokinase plasminogen activator receptor (uPAR) using functional proteomics.
25288800 2014 Kruppel-like factor-9 (KLF9) inhibits glioblastoma stemness through global transcription repression and integrin ?6 inhibition.
24982892 2014 Computational analysis of mRNA expression profiles identifies the ITG family and PIK3R3 as crucial genes for regulating triple negative breast cancer cell migration.
24955499 2014 Role of N-terminal residues in A? interactions with integrin receptor and cell surface.
24860089 2014 Neuroligin 1 induces blood vessel maturation by cooperating with the ?6 integrin.
24802970 2014 High CD49f expression is associated with osteosarcoma tumor progression: a study using patient-derived primary cell cultures.
24739392 2014 Targeting integrin ?6 stimulates curative-type bone metastasis lesions in a xenograft model.
24681327 2014 Monoclonal antibodies to human laminin ?4 chain globular domain inhibit tumor cell adhesion and migration on laminins 411 and 421, and binding of ?6?1 integrin and MCAM to ?4-laminins.
24564203 2013 ITGA6 gene silencing by RNA interference modulates the expression of a large number of cell migration-related genes in human thymic epithelial cells.
24418536 2014 HPV16 infection of HaCaTs is dependent on ?4 integrin, and ?6 integrin processing.
24403311 2014 Integrin ?6A splice variant regulates proliferation and the Wnt/?-catenin pathway in human colorectal cancer cells.
24375374 2014 Validation of stem cell markers in clinical prostate cancer: ?6-integrin is predictive for non-aggressive disease.
24304619 2013 RNA interference targeting human integrin ?6 suppresses the metastasis potential of hepatocellular carcinoma cells.
24289209 2013 Suppression of anoikis in human intestinal epithelial cells: differentiation state-selective roles of ?2?1, ?3?1, ?5?1, and ?6?4 integrins.
24227711 2013 ?6?1 and ?7?1 integrins are required in Schwann cells to sort axons.
24180592 2013 The role of c-Src in integrin (?6?4) dependent translational control.
24091622 2013 Tumour-suppressive microRNA-29s inhibit cancer cell migration and invasion by targeting laminin-integrin signalling in head and neck squamous cell carcinoma.
24056178 2013 Bone marrow-derived mesenchymal stem cells enhance angiogenesis via their ?6?1 integrin receptor.
24042193 2013 Integrin alpha 6: a novel therapeutic target in esophageal squamous cell carcinoma.
24022922 2014 ?6-Integrin is required for the adhesion and vasculogenic potential of hemangioma stem cells.
24015244 2013 CD49f(high) cells retain sphere-forming and tumor-initiating activities in human gastric tumors.
23708747 2013 CD49f-positive cell population efficiently enriches colon cancer-initiating cells.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23611113 2013 Interaction of Necl-4/CADM4 with ErbB3 and integrin ?6 ?4 and inhibition of ErbB2/ErbB3 signaling and hemidesmosome disassembly.
23499737 2013 Parathyroid hormone-related protein regulates integrin ?6 and ?4 levels via transcriptional and post-translational pathways.
23496044 2013 Phenotypic spectrum of epidermolysis bullosa associated with ?6?4 integrin mutations.
23436775 2013 GLI1 regulates a novel neuropilin-2/?6?1 integrin based autocrine pathway that contributes to breast cancer initiation.
23306848 2013 A high level of integrin ?6 expression in human intrahepatic cholangiocarcinoma cells is associated with a migratory and invasive phenotype.
23233446 2013 A proteomics and transcriptomics approach to identify leukemic stem cell (LSC) markers.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
23106339 2012 Site-specific S-nitrosylation of integrin ?6 increases the extent of prostate cancer cell migration by enhancing integrin ?1 association and weakening adherence to laminin-1.
23071686 2012 CD49f is an efficient marker of monolayer- and spheroid colony-forming cells of the benign and malignant human prostate.
23071680 2012 ?6 Integrin and CD44 enrich for a primary keratinocyte population that displays resistance to UV-induced apoptosis.
23070965 2012 A complex of ?6 integrin and E-cadherin drives liver metastasis of colorectal cancer cells through hepatic angiopoietin-like 6.
23045288 2013 Human osteosarcoma CD49f(-)CD133(+) cells: impaired in osteogenic fate while gain of tumorigenicity.
22843693 2012 Tetraspanin CD151 stimulates adhesion-dependent activation of Ras, Rac, and Cdc42 by facilitating molecular association between ?1 integrins and small GTPases.
22684562 2012 CD151 promotes proliferation and migration of PC3 cells via the formation of CD151-integrin ?3/?6 complex.
22592262 2012 Inhibition of integrin ?6 expression by cell-free varicella-zoster virus.
22514625 2012 Epcam, CD44, and CD49f distinguish sphere-forming human prostate basal cells from a subpopulation with predominant tubule initiation capability.
22493440 2012 ?6?4 integrin, a master regulator of expression of integrins in human keratinocytes.
22396498 2012 Endothelial expression of TNF receptor-1 generates a proapoptotic signal inhibited by integrin ?6?1 in glioblastoma.
22389315 2012 P-cadherin is coexpressed with CD44 and CD49f and mediates stem cell properties in basal-like breast cancer.
22351760 2012 Cross-talk between integrin ?6?4 and insulin-like growth factor-1 receptor (IGF1R) through direct ?6?4 binding to IGF1 and subsequent ?6?4-IGF1-IGF1R ternary complex formation in anchorage-independent conditions.
22328509 2012 CD151 restricts the ?6 integrin diffusion mode.
22314500 2012 Palmitoylation by DHHC3 is critical for the function, expression, and stability of integrin ?6?4.
22311737 2012 CD49f enhances multipotency and maintains stemness through the direct regulation of OCT4 and SOX2.
22295105 2012 The increased expression of integrin ?6 (ITGA6) enhances drug resistance in EVI1(high) leukemia.
22049212 2012 Integrin ?6?4 cooperates with LPA signaling to stimulate Rac through AKAP-Lbc-mediated RhoA activation.
21969027 2012 Lethal junctional epidermolysis bullosa with pyloric atresia due to compound heterozygosity for two novel mutations in the integrin ?4 gene.
21880726 2011 Interaction of nectin-like molecule 2 with integrin alpha6beta4 and inhibition of disassembly of integrin alpha6beta4 from hemidesmosomes.
21799154 2011 Netrin-4 activates endothelial integrin {alpha}6{beta}1.
21752283 2011 Integrin subunits alpha5 and alpha6 regulate cell cycle by modulating the chk1 and Rb/E2F pathways to affect breast cancer metastasis.
21558389 2011 PHLDA1 expression marks the putative epithelial stem cells and contributes to intestinal tumorigenesis.
21518455 2011 Peripheral myelin protein-22 (PMP22) modulates alpha 6 integrin expression in the human endometrium.
21474814 2011 Laminin-binding integrins induce Dll4 expression and Notch signaling in endothelial cells.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21388972 2011 Curcumin inhibition of the functional interaction between integrin ?6?4 and the epidermal growth factor receptor.
21359644 2011 Effects of integrin ?6?1 on migration of hepatocellular carcinoma cells.
21310825 2011 The androgen receptor induces integrin ?6?1 to promote prostate tumor cell survival via NF-?B and Bcl-xL Independently of PI3K signaling.
21269460 2011 Initial characterization of the human central proteome.
21195710 2011 Melanoma cells produce multiple laminin isoforms and strongly migrate on ?5 laminin(s) via several integrin receptors.
21182210 2010 Lack of association between markers in the ITGA3, ITGAV, ITGA6 and ITGB3 and autism in an Irish sample.
21115897 2010 Effect of {beta}4 integrin knockdown by RNA interference in anaplastic thyroid carcinoma.
20927591 2011 Expression and prognostic significance of CD151, c-Met, and integrin alpha3/alpha6 in pancreatic ductal adenocarcinoma.
20878950 2011 Inherited genetic markers discovered to date are able to identify a significant number of men at considerably elevated risk for prostate cancer.
20855525 2010 SHP2 mediates the localized activation of Fyn downstream of the ?6?4 integrin to promote carcinoma invasion.
20695903 2010 Interaction of integrin alpha(6)beta(4) with ErbB3 and implication in heregulin-induced ErbB3/ErbB2-mediated DNA synthesis.
20682778 2010 Direct binding of the EGF-like domain of neuregulin-1 to integrins ({alpha}v{beta}3 and {alpha}6{beta}4) is involved in neuregulin-1/ErbB signaling.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20564319 2010 Prostate cancer risk-associated variants reported from genome-wide association studies: meta-analysis and their contribution to genetic Variation.
20563599 2010 Integrin expression and integrin-mediated adhesion in vitro of human multipotent stromal cells (MSCs) to endothelial cells from various blood vessels.
20508204 2010 alpha6-integrin subunit plays a major role in the proangiogenic properties of endothelial progenitor cells.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20452317 2010 Integrin alpha 6 regulates glioblastoma stem cells.
20441998 2010 Usage of heparan sulfate, integrins, and FAK in HPV16 infection.
20432448 2010 The laminin binding integrin alpha6beta1 in prostate cancer perineural invasion.
19933311 2010 Characterization of integrin engagement during defined human embryonic stem cell culture.
19827952 2010 TGF-beta enhances the integrin alpha2beta1-mediated attachment of mesenchymal stem cells to type I collagen.
19808905 2009 Integrin (alpha6beta4) signals through Src to increase expression of S100A4, a metastasis-promoting factor: implications for cancer cell invasion.
19775453 2009 The interaction of HAb18G/CD147 with integrin alpha6beta1 and its implications for the invasion potential of human hepatoma cells.
19767753 2009 Identification of seven new prostate cancer susceptibility loci through a genome-wide association study.
19586553 2009 Integrin alpha6Bbeta4 inhibits colon cancer cell proliferation and c-Myc activity.
19579970 2009 An immunohistochemical study of beta1 integrin molecules (VLA-4, VLA-5, VLA-6) in all endometrial compartments of fertile and infertile women in Ahwaz-Iran.
19491258 2009 Extracellular engagement of alpha6 integrin inhibited urokinase-type plasminogen activator-mediated cleavage and delayed human prostate bone metastasis.
19364818 2009 Fas-mediated apoptosis is regulated by the extracellular matrix protein CCN1 (CYR61) in vitro and in vivo.
19242489 2009 Structural basis of the interaction between integrin alpha6beta4 and plectin at the hemidesmosomes.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19138983 2008 Curcumin inhibition of integrin (alpha6beta4)-dependent breast cancer cell motility and invasion.
19130304 2009 Integrin expression levels correlate with invasion, metastasis and prognosis of oral squamous cell carcinoma.
19124484 2009 Coexpression of alpha6beta4 integrin and guanine nucleotide exchange factor Net1 identifies node-positive breast cancer patients at high risk for distant metastasis.
19107504 2009 Differential expression of the integrins alpha6Abeta4 and alpha6Bbeta4 along the crypt-villus axis in the human small intestine.
18974120 2008 A key tyrosine (Y1494) in the beta4 integrin regulates multiple signaling pathways important for tumor development and progression.
18971471 2008 Conditional deletion of the Itgb4 integrin gene in Schwann cells leads to delayed peripheral nerve regeneration.
18958175 2008 The role of alpha 6 integrin in prostate cancer migration and bone pain in a novel xenograft model.
18842099 Blockade of alpha6-integrin reveals diversity in homing patterns among human, baboon, and murine cells.
18831072 2009 Overexpression of CD49f in precursor B-cell acute lymphoblastic leukemia: potential usefulness in minimal residual disease detection.
18818395 2009 The CD34-like protein PODXL and alpha6-integrin (CD49f) identify early progenitor MSCs with increased clonogenicity and migration to infarcted heart in mice.
18814027 2009 Endothelial cell-laminin interaction: modulation of LDH expression involves alpha6beta4 integrin-FAK-p38MAPK pathway.
18687805 2008 Thrombin receptor and RhoA mediate cell proliferation through integrins and cysteine-rich protein 61.
18614994 2008 Integrins mediate adherence and migration of T lymphocytes on human peritoneal mesothelial cells.
18550570 2008 Polymorphisms in predicted microRNA-binding sites in integrin genes and breast cancer: ITGB4 as prognostic marker.
18451146 2008 CD151 accelerates breast cancer by regulating alpha 6 integrin function, signaling, and molecular organization.
18436868 2008 CD117-positive cells in adult human heart are localized in the subepicardium, and their activation is associated with laminin-1 and alpha6 integrin expression.
18270579 2008 Induction of ErbB-3 expression by alpha6beta4 integrin contributes to tamoxifen resistance in ERbeta1-negative breast carcinomas.
18155160 2008 Enrichment of corneal epithelial stem/progenitor cells using cell surface markers, integrin alpha6 and CD71.
17979890 Increased VEGFR2 expression during human late endothelial progenitor cells expansion enhances in vitro angiogenesis with up-regulation of integrin alpha(6).
17935134 2008 Alpha-6 integrin is necessary for the tumourigenicity of a stem cell-like subpopulation within the MCF7 breast cancer cell line.
17652716 2007 Laminin reduces expression of the human alpha6 integrin subunit gene by altering the level of the transcription factors Sp1 and Sp3.
17475774 2007 Inhibition of integrin-mediated crosstalk with epidermal growth factor receptor/Erk or Src signaling pathways in autophagic prostate epithelial cells induces caspase-independent death.
17452356 2007 Non-EST-based prediction of novel alternatively spliced cassette exons with cell signaling function in Caenorhabditis elegans and human.
17332515 2007 Stem cell activity of human side population and alpha6 integrin-bright keratinocytes defined by a quantitative in vivo assay.
17303120 2007 Integrin alpha6 cleavage: a novel modification to modulate cell migration.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
17085437 2006 Integrin regulation by vascular endothelial growth factor in human brain microvascular endothelial cells: role of alpha6beta1 integrin in angiogenesis.
16973601 2006 Integrin beta4 regulates migratory behavior of keratinocytes by determining laminin-332 organization.
16965770 2006 PTH-related protein upregulates integrin alpha6beta4 expression and activates Akt in breast cancer cells.
16940506 2006 Keratinocyte-secreted laminin 5 can function as a transient receptor for human papillomaviruses by binding virions and transferring them to adjacent cells.
16870608 2006 Laminin 5 regulates polycystic kidney cell proliferation and cyst formation.
16757171 2006 Current insights into the formation and breakdown of hemidesmosomes.
16754960 2006 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins.
16732726 2006 The role of beta1 integrin subfamily in anchorage-dependent apoptosis of breast carcinoma cells differing in multidrug resistance.
16581764 2006 Multiple functions of the integrin alpha6beta4 in epidermal homeostasis and tumorigenesis.
16571677 2006 A critical role for tetraspanin CD151 in alpha3beta1 and alpha6beta4 integrin-dependent tumor cell functions on laminin-5.
16537545 2006 Contrasting effects of EWI proteins, integrins, and protein palmitoylation on cell surface CD9 organization.
16504015 2006 Interleukin-1alpha enhances the aggressive behavior of pancreatic cancer cells by regulating the alpha6beta1-integrin and urokinase plasminogen activator receptor expression.
16436605 2006 Peripheral myelin protein 22 is in complex with alpha6beta4 integrin, and its absence alters the Schwann cell basal lamina.
16424229 2006 Identification of an epitope within human integrin alpha 6 subunit for the binding of autoantibody and its role in basement membrane separation in oral pemphigoid.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16339173 2006 Laminin-5-integrin interaction signals through PI 3-kinase and Rac1b to promote assembly of adherens junctions in HT-29 cells.
16263699 2006 Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.
16258729 2005 Mobilization and activation of a signaling competent alpha6beta4integrin underlies its contribution to carcinoma progression.
16228294 2005 The integrin alpha6beta1 modulation of PI3K and Cdc42 activities induces dynamic filopodium formation in human platelets.
15983209 2005 Role for beta1 integrin and its associated alpha3, alpha5, and alpha6 subunits in development of the human fetal pancreas.
15897878 2005 Integrin alpha6beta4 promotes expression of autotaxin/ENPP2 autocrine motility factor in breast carcinoma cells.
15885076 2005 Selective down-regulation of the alpha6-integrin subunit in melanocytes by UVB light.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15679046 2004 Collagen type IV, laminin, alpha-smooth muscle actin (alphaSMA), alpha1 and alpha6 integrins expression in the liver with metastases from malignant gastrointestinal tumours.
15611341 2004 Palmitoylation supports assembly and function of integrin-tetraspanin complexes.
15579904 2005 Integrin alpha6beta4-erbB2 complex inhibits haptotaxis by up-regulating E-cadherin cell-cell junctions in keratinocytes.
15557282 2005 Tetraspanin CD82 attenuates cellular morphogenesis through down-regulating integrin alpha6-mediated cell adhesion.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361064 2005 The disintegrin domain of ADAM9: a ligand for multiple beta1 renal integrins.
15302884 2004 The cAMP-Epac-Rap1 pathway regulates cell spreading and cell adhesion to laminin-5 through the alpha3beta1 integrin but not the alpha6beta4 integrin.
15194479 2004 Bacterial heat shock protein 60 may increase epithelial cell migration through activation of MAP kinases and inhibition of alpha6beta4 integrin expression.
15161909 2004 The Met receptor and alpha 6 beta 4 integrin can function independently to promote carcinoma invasion.
14707725 2004 Expression of integrins in intraductal papillary-mucinous tumors of the pancreas as an indicator of malignancy.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14607975 2003 Characterization of the ligand-binding specificities of integrin alpha3beta1 and alpha6beta1 using a panel of purified laminin isoforms containing distinct alpha chains.
14602071 2003 Recognition of the neural chemoattractant Netrin-1 by integrins alpha6beta4 and alpha3beta1 regulates epithelial cell adhesion and migration.
14517202 2003 Compartmentalization of integrin alpha6beta4 signaling in lipid rafts.
12931024 2003 Interleukin-1alpha enhances integrin alpha(6)beta(1) expression and metastatic capability of human pancreatic cancer.
12919677 2003 The MSP receptor regulates alpha6beta4 and alpha3beta1 integrins via 14-3-3 proteins in keratinocyte migration.
12909644 2003 Recognition of the N-terminal modules of thrombospondin-1 and thrombospondin-2 by alpha6beta1 integrin.
12826661 2003 Identification of a novel integrin alpha 6 beta 1 binding site in the angiogenic inducer CCN1 (CYR61).
12802069 2003 Interaction of the bullous pemphigoid antigen 1 (BP230) and desmoplakin with intermediate filaments is mediated by distinct sequences within their COOH terminus.
12791251 2003 Structural and functional analysis of the actin binding domain of plectin suggests alternative mechanisms for binding to F-actin and integrin beta4.
12584562 2003 Alpha6beta1 integrin induces proteasome-mediated cleavage of erbB2 in breast cancer cells.
12499048 2003 Transforming growth factor-beta-inducible gene-h3 (beta(ig)-h3) promotes cell adhesion of human astrocytoma cells in vitro: implication of alpha6beta4 integrin.
12482924 2003 Analysis of the interactions between BP180, BP230, plectin and the integrin alpha6beta4 important for hemidesmosome assembly.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429829 2002 Dynamics of the alpha6beta4 integrin in keratinocytes.
12397374 2002 Crucial role of fibroblasts in regulating epidermal morphogenesis.
12364323 2002 Pro-angiogenic activities of CYR61 (CCN1) mediated through integrins alphavbeta3 and alpha6beta1 in human umbilical vein endothelial cells.
12105188 2002 Integrin (alpha 6 beta 4) regulation of eIF-4E activity and VEGF translation: a survival mechanism for carcinoma cells.
12033289 2002 Identification of components of protein complexes using a fluorescent photo-cross-linker and mass spectrometry.
11988844 Different phenotypes in human prostate cancer: alpha6 or alpha3 integrin in cell-extracellular adhesion sites.
11959811 2002 Differential regulation of a novel variant of the alpha(6) integrin, alpha(6p).
11884516 2002 Association of the tetraspanin CD151 with the laminin-binding integrins alpha3beta1, alpha6beta1, alpha6beta4 and alpha7beta1 in cells in culture and in vivo.
11861761 2002 Integrin-mediated functional polarization of Caco-2 cells through E-cadherin--actin complexes.
11852236 2002 The PDZ domain of TIP-2/GIPC interacts with the C-terminus of the integrin alpha5 and alpha6 subunits.
11809527 2002 Alteration of integrin expression relates to malignant progression of human papillomavirus-immortalized esophageal keratinocytes.
11739652 2001 Interactions of a hemidesmosome component and actinin family members.
11728829 2001 Mechanisms involved in alpha6beta1-integrin-mediated Ca(2+) signalling.
11684709 2001 EGF-R signaling through Fyn kinase disrupts the function of integrin alpha6beta4 at hemidesmosomes: role in epithelial cell migration and carcinoma invasion.
11479315 2001 PDZ interaction sites in integrin alpha subunits. T14853, TIP/GIPC binds to a type I recognition sequence in alpha 6A/alpha 5 and a novel sequence in alpha 6B.
11389095 2001 Protein kinase Cdelta-mediated phosphorylation of alpha6beta4 is associated with reduced integrin localization to the hemidesmosome and decreased keratinocyte attachment.
11359780 2001 Identification of a novel structural variant of the alpha 6 integrin.
11251584 2001 Alpha 6 beta 4 integrin abnormalities in junctional epidermolysis bullosa with pyloric atresia.
11238109 2001 CD36 associates with CD9 and integrins on human blood platelets.
10811835 2000 The tetraspan molecule CD151, a novel constituent of hemidesmosomes, associates with the integrin alpha6beta4 and may regulate the spatial organization of hemidesmosomes.
10713718 2000 The HIV-1 vpr protein induces anoikis-resistance by modulating cell adhesion process and microfilament system assembly.
10711425 2000 The tetraspanin CD9 associates with the integrin alpha6beta4 in cultured human epidermal keratinocytes and is involved in cell motility.
10671376 2000 Integrin binding specificity of laminin-10/11: laminin-10/11 are recognized by alpha 3 beta 1, alpha 6 beta 1 and alpha 6 beta 4 integrins.
10657249 2000 Endoproteolytic processing of integrin pro-alpha subunits involves the redundant function of furin and proprotein convertase (PC) 5A, but not paired basic amino acid converting enzyme (PACE) 4, PC5B or PC7.
10637308 2000 The N terminus of the transmembrane protein BP180 interacts with the N-terminal domain of BP230, thereby mediating keratin cytoskeleton anchorage to the cell surface at the site of the hemidesmosome.
10525545 1999 Binding of integrin alpha6beta4 to plectin prevents plectin association with F-actin but does not interfere with intermediate filament binding.
10477615 1999 The nonintegrin laminin binding protein (p67 LBP) is expressed on a subset of activated human T lymphocytes and, together with the integrin very late activation antigen-6, mediates avid cellular adherence to laminin.
10094488 1999 Identification of novel interaction partners for the conserved membrane proximal region of alpha-integrin cytoplasmic domains.
9660880 1998 Hemidesmosome formation is initiated by the beta4 integrin subunit, requires complex formation of beta4 and HD1/plectin, and involves a direct interaction between beta4 and the bullous pemphigoid antigen 180.
9500991 1998 Direct interaction between the intracellular domains of bullous pemphigoid antigen 2 (BP180) and beta 4 integrin, hemidesmosomal components of basal keratinocytes.
9425259 1997 Identification of regulatory elements of human alpha 6 integrin subunit gene.
9360996 1997 NAG-2, a novel transmembrane-4 superfamily (TM4SF) protein that complexes with integrins and other TM4SF proteins.
9360995 1997 Generation of monoclonal antibodies to integrin-associated proteins. Evidence that alpha3beta1 complexes with EMMPRIN/basigin/OX47/M6.
9185503 1997 A homozygous mutation in the integrin alpha6 gene in junctional epidermolysis bullosa with pyloric atresia.
9164866 1997 Identification of the cleavage sites in the alpha6A integrin subunit: structural requirements for cleavage and functional analysis of the uncleaved alpha6Abeta1 integrin.
9158140 1997 Homozygous alpha6 integrin mutation in junctional epidermolysis bullosa with congenital duodenal atresia.
8838570 1996 CD9 of mouse brain is implicated in neurite outgrowth and cell migration in vitro and is associated with the alpha 6/beta 1 integrin and the neural adhesion molecule L1.
8760366 1996 Lack of integrin alpha-chain endoproteolytic cleavage in furin-deficient human colon adenocarcinoma cells LoVo.
8757325 1996 Transmembrane-4 superfamily proteins CD81 (TAPA-1), CD82, CD63, and CD53 specifically associated with integrin alpha 4 beta 1 (CD49d/CD29).
8631745 1996 Cleavage of the alpha6A subunit is essential for activation of the alpha6Abeta1 integrin by phorbol 12-myristate 13-acetate.
8496190 1993 Inside-out integrin signaling in macrophages. Analysis of the role of the alpha 6A beta 1 and alpha 6B beta 1 integrin variants in laminin adhesion by cDNA expression in an alpha 6 integrin-deficient macrophage cell line.
8360143 1993 The role of phosphorylation in activation of the alpha 6A beta 1 laminin receptor.
8253814 1993 Alternative extracellular and cytoplasmic domains of the integrin alpha 7 subunit are differentially expressed during development.
8163531 1994 The integrin chains beta 1 and alpha 6 associate with the chaperone calnexin prior to integrin assembly.
7681434 1993 Biochemical characterization and tissue distribution of the A and B variants of the integrin alpha 6 subunit.
7629079 1995 Specific association of CD63 with the VLA-3 and VLA-6 integrins.
7583007 1995 An alternatively spliced exon in the extracellular domain of the human alpha 6 integrin subunit--functional analysis of the alpha 6 integrin variants.
7556090 1995 Signal transduction by the alpha 6 beta 4 integrin: distinct beta 4 subunit sites mediate recruitment of Shc/Grb2 and association with the cytoskeleton of hemidesmosomes.
2649503 1989 Association of the VLA alpha 6 subunit with a novel protein. A possible alternative to the common VLA beta 1 subunit on certain cell lines.
2542022 1989 A novel integrin (alpha E beta 4) from human epithelial cells suggests a fourth family of integrin adhesion receptors.
2070796 1991 Molecular cloning of the human alpha 6 integrin subunit. Alternative splicing of alpha 6 mRNA and chromosomal localization of the alpha 6 and beta 4 genes.
1976638 1990 Epithelial integrin alpha 6 beta 4: complete primary structure of alpha 6 and variant forms of beta 4.
1953640 1991 Separation of important new platelet glycoproteins (GPIa, GPIc, GPIc*, GPIIa and GMP-140) by f.p.l.c. Characterization by monoclonal antibodies and gas-phase sequencing.
1946438 1991 Cell type-specific integrin variants with alternative alpha chain cytoplasmic domains.
1476731 1992 An efficient and reliable method for cloning PCR-amplification products: a survey of point mutations in integrin cDNA.