Property Summary

NCBI Gene PubMed Count 191
PubMed Score 98.72
PubTator Score 101.14

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (9)

Gene RIF (121)

PMID Text
26788840 Expression of the alpha3-Integrin splice variants in the brain
26674523 Genetic and Immunohistochemical Expression of Integrins ITGAV, ITGA6, and ITGA3 As Prognostic Factor for Colorectal Cancer
26464707 In high grade DCIS, when stratified according to the HER2 status, in the HER2-negative subgroup, CD151 assessed in combination with alpha3beta1 was significantly correlated with prognosis.
26418968 the role of the CD151-alpha3beta1 complex in carcinoma progression is context dependent, and may depend on the mode of tumor cell invasion.
26377974 Data show that CD151 protein (CD151)-alpha3beta1 integrin complexes cooperated with epidermal growth factor receptor (EGFR) to drive tumor cell motility.
26350464 based on the interaction motifs in Sdc1 and Sdc4, called synstatins (SSTN210-240 and SSTN87-131) competitively displace the receptor tyrosine kinase and alpha3beta1 integrin from the syndecan with an IC50 of 100-300 nm
26318455 studies suggest that the presence and spacing of the RGD and synergy sites modulate integrin alpha3beta1 binding to Fn
25497870 Findings show that alpha3 integrin is essentially involved in head and neck squamous cell carcinoma (HNSCC) cell radioresistance.
25472585 ITGA3, ITGA6, ITGB3,ITGB4 and ITGB5 are associated with GC susceptibility (rs2675), ITGA3, ITGA6, ITGB3, ITGB4 and ITGB5 are associated with gastric cancer susceptibility tumor stage and lymphatic metastasis in Chinese Han population
25356755 our study demonstrates that CD151-alpha3beta1 integrin complexes regulate ovarian tumor growth by repressing Slug-mediated epithelial to mesenchymal transition and Wnt signaling
25096929 NOX4 is highly predictive of relapse in stage II left-side colon cancer, whereas integrin alpha 3 beta 1 (ITGA3) is predictive of relapse in stage II right-side colon cancer.
25078904 ITGA3 translocation to the plasma membrane suppressed by hypoxia through inhibition of glycosylation facilitated cell invasion in A431.
24985492 CTGF blocks integrin alpha3beta1-dependent adhesion of cancer cells.
24958723 Molecular modeling indicated that galactosylation occurred on the periphery of alpha2beta1 integrin interaction with alpha1(IV)382-393 but right in the middle of alpha3beta1 integrin interaction with alpha1(IV)531-543
24950714 COX2 and alpha3 are correlated in invasive ductal carcinoma independently of hormone receptor status or other clinicopathologic features, supporting the hypothesis that integrin alpha3beta1 is a determinant of COX2 expression in human breast cancer.
24675526 endothelial integrin alpha3beta1 stabilizes tumor/endothelial cell adhesion and induces the formation of macromolecular signaling complex activating several major signaling pathways in endothelial cells.
24621570 integrin-alpha3 mutation confers major renal developmental defects
24434582 Integrin alpha3beta1 mediates regulation of COX2 mRNA stability in human breast cancer cells.
24381140 ITGA3 gene polymorphism is associated with with susceptibility of osteosarcoma.
24289209 Integrin alpha2beta1 and integrin alpha3beta1 suppress anoikis in undifferentiated cells.
24220332 the calf-1 domain is required for the transport of alpha3 from the ER to the Golgi apparatus to maintain the integrity of epithelial tissues, and hence the impairment of the calf-1 domain by the R628P mutation leads to severe diseases of the kidneys, lungs, and skin.
24084442 High integrin alpha 3 expression is associated with malignant pleural mesothelioma.
24006899 Two types of metastatic trait were found in OSCC: locoregional dissemination, which was reflected by high-ITGA3/CD9, and distant metastasis through hematogenous dissemination, uniquely distinguished by high-ITGB4/JUP.
23786209 study concluded that ITGA3 is a potential molecular marker for cells undergoing enhanced epithelial-mesenchymal transition as well as for cancer cells with aggressive phenotypes; integrin alpha3 likely plays a crucial role in the progression of both cancer cells and fibroblastic cells in cancer microenvironments
23687274 These results showed evidence of Borrelia burgdorferi BB0172 localization in the outer membrane, the orientation of the vWFA domain to the extracellular environment, and its function as a metal ion-dependent integrin-binding protein.
23686814 The interaction between ephrin-As, Eph receptors and integrin alpha3 is plausibly important for the crosstalk between Eph and integrin signalling pathways at the membrane protrusions and in the migration of brain cancer cells.
23652300 Integrin alpha3 contributes to the invasive nature of glioma stem-like cell via ERK1/2, which renders integrin alpha3 a prime candidate for anti-invasion therapy for glioblastoma.
23613949 Both CD9/CD81-silenced cells and CD151-silenced cells showed delayed alpha3beta1-dependent cell spreading on laminin-332.
23590307 Suggest that fibronectin fine tunes LM332-mediated migration by boosting bronchiolar cell adhesion to substrate via integrin alpha3beta1 integrin.
23533596 CD151 is positively associated with the invasiveness of HGC, and CD151 or the combination of CD151 and integrin alpha3 is a novel marker for predicting the prognosis of HGC patient.
23248240 Data indicate that Slug siRNA suppressed the TGF-beta1-induced integrin alpha3beta1-mediated cell migration ability of squamous cell carcinoma HSC-4 cells.
23094960 These results suggest that Ets-1 is involved in transcriptional activation of the alpha3 integrin gene through its binding to the Ets-consensus sequence at -133 bp
23074279 Data show that TIMP-2-mediated inhibition of vascular endothelial cell permeability involves an integrin alpha3beta1-Shp-1-cAMP/protein kinase A-dependent vascular endothelial cadherin cytoskeletal association.
23011394 Loss of alpha3 integrin-adenomatous poliposis coli interaction promotes endothelial apoptosis.
22986527 Data indicate that alpha3beta1 and the tetraspanin CD151 directly associate at the front and retracting rear of polarised migrating breast carcinoma cells.
22917688 Most actinic cheilitis cases showed reduced expression of integrin alpha 3 and superficially invasive squamous cell carcinoma lacked intergrin alpha 3 in the invasive front.
22843693 CD151 links alpha(3)beta(1)/alpha(6)beta(1) integrins to Ras, Rac1, and Cdc42 by promoting the formation of multimolecular complexes in the membrane, which leads to the up-regulation of adhesion-dependent small GTPase activation
22684562 Taken together, it was concluded that CD151 promotes the proliferation and migration of PC3 cells through the formation of CD151-integrin complex and the activation of phosphorylated ERK.
22512483 We identified three patients with homozygous mutations in the integrin alpha(3) gene that were associated with disrupted basement-membrane structures and compromised barrier functions in kidney, lung, and skin.
21530503 With increased tension cytoskeletal stress fibers develop that contain alphaSMA and alphavbeta3 integrin that replaces alpha2beta1 integrin, consistent with cell switching from collagen to non-collagen proteins interactions.
21455571 radiation treatment enhances the migration of meningioma cells with the involvement of alpha3beta1 integrin-mediated signaling via FAK and ERK.
21195710 Data suggest that the alpha5 laminins emerge as putative primary extracellular matrix mediators of melanoma invasion and metastasis via alpha3/alpha6beta1 and other integrin receptors.
21182210 Studies have shown that ITGA3 plays a key role during cortical development, involved in neuronal migration and placement, as well as cortical layering
20927591 CD151, c-Met, and integrin alpha3/alpha6 were all overexpressed in pancreatic ductal adenocarcinoma. CD151 and c-Met might be new molecular markers to predict the prognosis of pancreatic ductal adenocarcinoma patients.
20926544 Observational study of gene-disease association. (HuGE Navigator)
20877569 U937 macrophage responses to the TLR2 ligand, Pam3CSK4, are dependent upon integrin alpha3beta1.
20412552 down-regulation of alpha3beta1 integrin recapitulates crucial events governing keratinocyte migration associated with wound healing and tissue repair.
20352300 The results suggest that the production of MMP-9 by MKN1 cells was potentiated by the alpha3beta1 integrin-laminin-5 interaction, which facilitated their invasion via degradation of the matrix.
19759146 Integrin alpha3 is a bona fide substrate of the adenovirus serotype 5 E4orf6 and E1B55K protein-formed cullin 5-based E3 ubiquitin ligase complex.
19755493 Gal-3 promotes epithelial cell migration by cross-linking MGAT5-modified complex N-glycans on alpha3beta1 integrin.
19752234 For the first time, alpha3- and alpha5-laminins are shown to promote both adhesion and migration of mast cells, and alpha1 integrin is shown to mediate cell migration.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19451223 Nox1 knockdown led to a loss of directional migration which takes place through a RhoA-dependent alpha2/alpha3 integrin switch.
19411307 alpha(2)-, alpha(3)-, and beta(1)-integrins and E-cadherin expression in normal human lung and bronchopulmonary sequestration and congenital cystic adenomatoid malformation were evaluated using Western blot and immunohistochemistry.
19339270 Observational study of gene-disease association. (HuGE Navigator)
19297475 a cellular protein that appeared to be degraded by E1B55K in combination with the E4orf6 protein was a species of molecular mass approximately 130 kDa that was identified as the integrin alpha3 subunit
19230171 Glomerular deposition of C5b-9 and a positive correlation with the intensity of tubular alpha3beta1-integrin suggests a possible implication in the development of tubulointerstitial fibrosis.
19224172 Proliferation activity and malignant grade of meningiomas were increased with decreased expression of integrin-alpha(3), and down-regulation of integrin-alpha(3) mRNA was associated with the invasive biological behaviors in meningiomas.
19130304 alpha 3, alpha 6A, and beta 1 integrin expression in cancer cells at the invasive front are related to the mode of invasion and prognosis in oral squamous cell carcinoma
19074885 Observational study of gene-disease association. (HuGE Navigator)
18839319 Src overexpression downregulates alpha3 integrin total protein expression and localization to the cell surface of HCT116 colon cancer cells. This indicates that Src activity may enhance metastasis by altering alpha3 integrin expression.
18695939 Results suggest that HAb18G/CD147 enhances the invasion and metastatic potentials of human hepatoma cells via integrin alpha3beta1-mediated FAK-paxillin and FAKPI3K-Ca(2+) signal pathways.
18550570 Observational study of gene-disease association. (HuGE Navigator)
18492066 CD151 regulates integrin alpha3beta1 functions in two independent aspects: potentiation of integrin alpha3beta1-mediated cell adhesion and promotion of integrin alpha3beta1-stimulated signaling events involving tyrosine phosphorylation
18464290 Both integrins, v3 and v5, are involved in the glioma cell radioresistance through the integrin-linked kinase (ILK) and the small GTPase RhoB, at least by regulating the radiation-induced mitotic cell death.
18384059 Observational study of gene-disease association. (HuGE Navigator)
18224668 Increase in ITGA3 is associated with lymph node metastasis in squamous cell carcinoma of the tongue
17997226 These results strongly suggest that enhanced expression of alpha3beta1 integrin on hepatocellular carcinoma cells is directly involved in their malignant phenotypes such as invasion and metastasis.
17888902 identification of alpha3beta1 as the predominant integrin and laminin receptor in glioma cells, and as a brain invasion-mediating integrin
17630833 Beta1 and alpha3 integrins are functionally important receptors for type 1 pili-expressing bacteria within the urinary tract and possibly at other sites within the host.
17498594 findings suggest an important role of integrin alpha2beta1, alpha3beta1, and alpha5beta1 in the architectural characteristics of ameloblastomas and adenomatoid odentogenic tumor
17481915 These results indicate that binding of the alpha3beta1 integrin results in a suppression in the activation of the IL-1 induced intracellular signaling pathway from JNK to AP-1.
17475774 Integrin-mediated adhesion via alpha3beta1, but not alpha6beta4 integrin, supports cell survival through EGFR by signaling downstream to Erk.
17265493 Chondrocytes with low chondrogenic capacity expressed higher levels of IGF-1, MMP-2, aggrecanase 2, while chondrocytes with high chondrogenic capacity expressed higher levels of CD44, CD151, and CD49c.
16785564 Binding of Borrelia burgdorferi to integrin alpha 3 beta 1 results in release of inflammatory mediators from human chondrocytes and is proposed as a Toll-like receptor-independent pathway for activation of the innate immune response.
16732726 Acquisition of multiple antitumor drugs was accompanied by a drastically reduced expression of alpha3beta1 in the adenocarcinoma cells.
16731529 integrin alpha3beta1 is a receptor for the alpha3NC1 domain and transdominantly inhibits integrin alphavbeta3 activation
16707493 Slug regulates integrin alpha3, beta1, and beta4 expression and cell proliferation in human epidermal keratinocytes
16571677 Both integrin alpha3beta1- and alpha6beta4-dependent cell adhesion to laminin-5 were also impaired in CD151-silenced cells.
16537545 EWI proteins EWI-2 and EWI-F, alpha3beta1 and alpha6beta4 integrins, and protein palmitoylation have contrasting effects on cell surface CD9 organization
16510444 This study supports matrix-induced clustering of alpha3beta1 integrin promotes uPAR/alpha3beta1 interaction; potentiating cellular signal transduction pathways culminating in activation of uPA expression and enhanced uPA-dependent invasive behavior.
16475024 TGF-beta1 stimulates hepatoma cells to express a higher level of alpha3 integrin by transcriptional upregulation via Ets transcription factors and to exhibit a more invasive phenotype.
16459165 decreased podocyte expression of alpha3beta1 integrins is closely related with podocyte depletion, glomerular sclerosis, and daily protein loss in patients with primary focal glomerulosclerosis
16390868 Results suggest that loss of E-cadherin function is linked to regulation of cell-cell and cell-matrix adhesion, based in part on cell surface expression of alpha2, alpha3 and beta1 integrins.
16373174 Our data show that alpha3beta1 integrin function may be altered by glycosylation, that both subunits contribute to these changes, and glycosylation may be considered a newly found mechanism in the regulation of integrin function.
16339173 Data show that alpha6 and alpha3 integrin subunits interact with laminin 5 to increase expression of E-cadherin, and suggest that phosphoinositide 3-kinase (PI 3-kinase) activation plays a key role in this cross-talk.
16307893 Thus, the integrin/Src pathway negatively regulates the induction of long-term plasticity at inhibitory synapses on a cerebellar Purkinje cells.
16273094 localized expression of the integrin alpha3 protein is regulated at the level of RNA localization by MBNL1; integrin alpha3 transcripts are physically associated with MLP1 in cells and MLP1 binds to a specific ACACCC motif in the integrin alpha3 3' UTR
16103120 phenotypic conversion and reversion of bladder cancer cells is controlled by a glycosynapse 3 microdomain through GM3-mediated interaction of alpha3beta1 integrin with CD9
16055706 the signaling network involving Smad-dependent TGFbeta, PKCdelta, and integrin alpha2beta1/alpha3beta1, regulates cell spreading, motility, and invasion of the SNU16mAd gastric carcinoma cell variant
15983209 alpha3, alpha5, and alpha6 beta1 integrins are expressed in ductal cells at 8 weeks, before glucagon- and insulin-immunoreactive cells bud off in fetal pancrea.
15919367 alpha3beta1 integrin binding results in a suppression of the interleukin-1 signaling pathway leading to the activation of NF-(kappa)B
15878864 KSHV gB can activate VEGFR-3 on the microvascular endothelium and modulate endothelial cell migration and proliferation via an interaction between the alpha3beta1 integrin and the VEGFR-3 receptor
15805105 Beta ig-h3 induces keratinocyte differentiation via modulation of involucrin and transglutaminase expression through the integrin alpha3beta1 and the phosphatidylinositol 3-kinase/Akt signaling pathway
15677332 Results indicate that CD151 association modulates the ligand-binding activity of integrin alpha3beta1 through stabilizing its activated conformation not only with purified proteins but also in a physiological context.
15351855 Observational study of gene-disease association. (HuGE Navigator)
15346842 Observational study of gene-disease association. (HuGE Navigator)
15302884 cAMP-Epac-Rap1 pathway regulates cell spreading and cell adhesion to laminin-5 through the alpha3beta1 integrin but not the alpha6beta4 integrin
15280429 Alpha 3 beta 1 integrin is necessary and sufficient for maximal keratinocyte survival on laminin-5.
15194015 Observational study of gene-environment interaction. (HuGE Navigator)
15109703 Observational study of gene-disease association. (HuGE Navigator)
15024036 Data suggest that the early arrest of tumor cells in the pulmonary vasculature through interaction of alpha3beta1 integrin with laminin-5 in exposed basement membrane provides a basis for cell arrest during pulmonary metastasis.
14706682 Observational study of gene-disease association. (HuGE Navigator)
14666169 alpha3beta1, alpha4beta1 and alphaVbeta1 integrins may play an important role in the implantation process
14662754 results show how laterally associated EWI-2 might regulate alpha3beta1 function in disease and development, and demonstrate how tetraspanin proteins can assemble multiple nontetraspanin proteins into functional complexes
14645603 results suggest that a direct interaction occurs between the Adenovirus penton base protein and the integrin receptor alpha3beta1 in vitro and in vivo
14612440 alpha3beta1 integrin binding to laminin-5 depends on its proteolytic processing
14607975 ligand-binding specificities of integrin alpha3beta1 and alpha6beta1
14602071 Data demonstrate that alpha6beta4 integrin mediates pancreatic epithelial cell adhesion to Netrin-1, whereas recruitment of alpha6beta4 and alpha3beta1 regulate the migration of putative pancreatic progenitors on Netrin-1.
14596610 Disulfide bonding patterns of the integrin alpha 3 chain are described; the alpha chain displays differences in the disulfide patterns of those bonds near their C-terminal regions linking the heavy and light chains.
12919677 Data show that macrophage stimulating protein (MSP) and its receptor (Ron) induce phosphorylation of both Ron and alpha6beta4 integrin, and result in activation of alpha3beta1 integrin.
12775419 Genes, including GABRP, ADF, HINT, PRSS2, SDCBP, PTK9, PPP2R5B, ITGA3, PRKCBP1, HMOX2, HAT1, PPP1cB, and ICAM-1, are upregulated after treatment of human astrocytes with HIV-1 gp120
12717361 signaling through both constitutively expressed alpha2 integrin and Matrigel-induced alpha3 integrin expression is required to acquire a differentiated phenotype in Caco-2 cells.
12699087 expression of alpha3 integrin subunit is responsible for differentiation-associated changes in cells behavior in terminally differentiated oral keratinocytes
12615788 Observational study of gene-disease association. (HuGE Navigator)
12452046 Integrin-alpha 3 sub-unit participates the process of regulating growth of meningiomas.
12372459 initial adhesion of endometrial cells to mesothelium is not mediated by alpha(3)beta(1)integrin
12119179 Genes, including GABRP, ADF, HINT, PRSS2, SDCBP, PTK9, PPP2R5B, ITGA3, PRKCBP1, HMOX2, HAT1, PPP1cB, and ICAM-1, are upregulated after treatment of human astrocytes with HIV-1 gp120
11988844 Human prostate tumors display on their cell surface the alpha6beta1 and/or alpha3beta1 integrins
11907260 Data demonstrate that multiple tetraspanin (transmembrane 4 superfamily) proteins such as CD151 are palmitoylated, and that palmitoylation is not required for cd151-alpha3beta1 integrin association.
9223324 Genes, including GABRP, ADF, HINT, PRSS2, SDCBP, PTK9, PPP2R5B, ITGA3, PRKCBP1, HMOX2, HAT1, PPP1cB, and ICAM-1, are upregulated after treatment of human astrocytes with HIV-1 gp120

AA Sequence

MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHRQTERQQRYLL      1 - 70
LAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVC     71 - 140
AHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTSGGFTQNTV    141 - 210
YFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGA    211 - 280
VFLLSQEAGGDLRRRQVLEGSQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAG    281 - 350
TSFPAHPSLLLHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGE    351 - 420
KLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVPRPAVLDPALCTATSC    421 - 490
VQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDN    491 - 560
LRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQAQALENHTEVQFQKECGPDNKCESNLQMRAA    561 - 630
FVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETI    631 - 700
FCELGNPFKRNQRMELLIAFEVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMVNHR    701 - 770
LQSFFGGTVMGESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHG    771 - 840
NGSWPCRPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSETVLTCATGRAH    841 - 910
CVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRTSIPTINMENKTTWFSVDIDS    911 - 980
ELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFKRARTRALYEAKRQKAEMKSQPSETERLTDD    981 - 1050
Y//

Text Mined References (195)

PMID Year Title
26788840 2016 Development of Splice Variant-Specific Monoclonal Antibodies Against Human ?3 Integrin.
26674523 2015 Genetic and Immunohistochemical Expression of Integrins ITGAV, ITGA6, and ITGA3 As Prognostic Factor for Colorectal Cancer: Models for Global and Disease-Free Survival.
26464707 2015 Expression of CD151/Tspan24 and integrin alpha 3 complex in aid of prognostication of HER2-negative high-grade ductal carcinoma in situ.
26418968 2015 CD151 promotes ?3?1 integrin-dependent organization of carcinoma cell junctions and restrains collective cell invasion.
26377974 2015 CD151-?3?1 integrin complexes are prognostic markers of glioblastoma and cooperate with EGFR to drive tumor cell motility and invasion.
26350464 2015 Syndecan-1 and Syndecan-4 Capture Epidermal Growth Factor Receptor Family Members and the ?3?1 Integrin Via Binding Sites in Their Ectodomains: NOVEL SYNSTATINS PREVENT KINASE CAPTURE AND INHIBIT ?6?4-INTEGRIN-DEPENDENT EPITHELIAL CELL MOTILITY.
26318455 2015 Integrin ?3?1 Binding to Fibronectin Is Dependent on the Ninth Type III Repeat.
25808196 2015 Intensified antineoplastic effect by combining an HDAC-inhibitor, an mTOR-inhibitor and low dosed interferon alpha in prostate cancer cells.
25497870 2015 ? integrin targeting for radiosensitization of three-dimensionally grown human head and neck squamous cell carcinoma cells.
25472585 2015 Association between polymorphisms of microRNA-binding sites in integrin genes and gastric cancer in Chinese Han population.
25356755 2014 CD151-?3?1 integrin complexes suppress ovarian tumor growth by repressing slug-mediated EMT and canonical Wnt signaling.
25096929 2014 Proteomic and functional investigation of the colon cancer relapse-associated genes NOX4 and ITGA3.
25078904 2014 Hypoxia-induced changes to integrin ? 3 glycosylation facilitate invasion in epidermoid carcinoma cell line A431.
25063885 2014 KSHV attachment and entry are dependent on ?V?3 integrin localized to specific cell surface microdomains and do not correlate with the presence of heparan sulfate.
24985492 2015 Connective tissue growth factor inhibits gastric cancer peritoneal metastasis by blocking integrin ?3?1-dependent adhesion.
24958723 2014 Glycosylation modulates melanoma cell ?2?1 and ?3?1 integrin interactions with type IV collagen.
24950714 2014 Expression of integrin ?3?1 and cyclooxygenase-2 (COX2) are positively correlated in human breast cancer.
24675526 2014 Endothelial integrin ?3?1 stabilizes carbohydrate-mediated tumor/endothelial cell adhesion and induces macromolecular signaling complex formation at the endothelial cell membrane.
24621570 2014 A human integrin-?3 mutation confers major renal developmental defects.
24434582 2014 Integrin ?3?1 controls mRNA splicing that determines Cox-2 mRNA stability in breast cancer cells.
24381140 2014 Association of ITGA3 gene polymorphisms with susceptibility and clinicopathological characteristics of osteosarcoma.
24289209 2013 Suppression of anoikis in human intestinal epithelial cells: differentiation state-selective roles of ?2?1, ?3?1, ?5?1, and ?6?4 integrins.
24220332 2013 Disease-associated single amino acid mutation in the calf-1 domain of integrin ?3 leads to defects in its processing and cell surface expression.
24084442 2013 Differential expression of extracellular matrix constituents and cell adhesion molecules between malignant pleural mesothelioma and mesothelial hyperplasia.
24006899 2013 ITGA3 and ITGB4 expression biomarkers estimate the risks of locoregional and hematogenous dissemination of oral squamous cell carcinoma.
23786209 2013 Identification of integrin ?3 as a molecular marker of cells undergoing epithelial-mesenchymal transition and of cancer cells with aggressive phenotypes.
23687274 2013 BB0172, a Borrelia burgdorferi outer membrane protein that binds integrin ?3?1.
23686814 2013 Ephrin-As, Eph receptors and integrin ?3 interact and colocalise at membrane protrusions of U251MG glioblastoma cells.
23652300 2013 Integrin ?3 is overexpressed in glioma stem-like cells and promotes invasion.
23613949 2013 The CD9/CD81 tetraspanin complex and tetraspanin CD151 regulate ?3?1 integrin-dependent tumor cell behaviors by overlapping but distinct mechanisms.
23590307 2013 Laminin-332 and ?3?1 integrin-supported migration of bronchial epithelial cells is modulated by fibronectin.
23533596 2013 Overexpression of CD151 predicts prognosis in patients with resected gastric cancer.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23248240 2013 Transforming growth factor-?1 induces epithelial-mesenchymal transition and integrin ?3?1-mediated cell migration of HSC-4 human squamous cell carcinoma cells through Slug.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
23094960 2012 Involvement of transcription factor Ets-1 in the expression of the ?3 integrin subunit gene.
23074279 2012 Antagonism of VEGF-A-induced increase in vascular permeability by an integrin ?3?1-Shp-1-cAMP/PKA pathway.
23011394 2012 Loss of adenomatous poliposis coli-?3 integrin interaction promotes endothelial apoptosis in mice and humans.
22986527 2013 ?3?1 integrins regulate CD151 complex assembly and membrane dynamics in carcinoma cells within 3D environments.
22917688 2012 Expression of laminin-5 and integrins in actinic cheilitis and superficially invasive squamous cell carcinomas of the lip.
22843693 2012 Tetraspanin CD151 stimulates adhesion-dependent activation of Ras, Rac, and Cdc42 by facilitating molecular association between ?1 integrins and small GTPases.
22684562 2012 CD151 promotes proliferation and migration of PC3 cells via the formation of CD151-integrin ?3/?6 complex.
22512483 2012 Integrin ?3 mutations with kidney, lung, and skin disease.
21530503 2011 Fibroblast expression of ?-smooth muscle actin, ?2?1 integrin and ?v?3 integrin: influence of surface rigidity.
21455571 2011 ?3?1 integrin promotes radiation-induced migration of meningioma cells.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21310825 2011 The androgen receptor induces integrin ?6?1 to promote prostate tumor cell survival via NF-?B and Bcl-xL Independently of PI3K signaling.
21269460 2011 Initial characterization of the human central proteome.
21195710 2011 Melanoma cells produce multiple laminin isoforms and strongly migrate on ?5 laminin(s) via several integrin receptors.
21182210 2010 Lack of association between markers in the ITGA3, ITGAV, ITGA6 and ITGB3 and autism in an Irish sample.
20927591 2011 Expression and prognostic significance of CD151, c-Met, and integrin alpha3/alpha6 in pancreatic ductal adenocarcinoma.
20926544 2011 Allele polymorphisms of tumor integrins correlate with peritoneal carcinosis capability of gastric cancer cells in radically resected patients.
20877569 2010 Human integrin ?(3)?(1) regulates TLR2 recognition of lipopeptides from endosomal compartments.
20624931 2010 Unique and redundant functions of integrins in the epidermis.
20563599 2010 Integrin expression and integrin-mediated adhesion in vitro of human multipotent stromal cells (MSCs) to endothelial cells from various blood vessels.
20412552 Integrin alpha3 subunit regulates events linked to epithelial repair, including keratinocyte migration and protein expression.
20352300 2010 Potentiation of cell invasion and matrix metalloproteinase production by alpha3beta1 integrin-mediated adhesion of gastric carcinoma cells to laminin-5.
19933311 2010 Characterization of integrin engagement during defined human embryonic stem cell culture.
19759146 2009 A proteomic approach to identify candidate substrates of human adenovirus E4orf6-E1B55K and other viral cullin-based E3 ubiquitin ligases.
19755493 2009 Galectin-3 promotes lamellipodia formation in epithelial cells by interacting with complex N-glycans on alpha3beta1 integrin.
19752234 2009 Human mast cells adhere to and migrate on epithelial and vascular basement membrane laminins LM-332 and LM-511 via alpha3beta1 integrin.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19451223 2009 NADPH oxidase 1 controls the persistence of directed cell migration by a Rho-dependent switch of alpha2/alpha3 integrins.
19411307 2009 Aberrant cell adhesion molecule expression in human bronchopulmonary sequestration and congenital cystic adenomatoid malformation.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19297475 2009 Identification of integrin alpha3 as a new substrate of the adenovirus E4orf6/E1B 55-kilodalton E3 ubiquitin ligase complex.
19230171 2008 C5b-9 glomerular deposition and tubular alpha3beta1-integrin expression are implicated in the development of chronic lesions and predict renal function outcome in immunoglobulin A nephropathy.
19224172 2009 Expression of integrin-alpha(3) mRNA in meningiomas and its correlation with proliferation and invasion.
19130304 2009 Integrin expression levels correlate with invasion, metastasis and prognosis of oral squamous cell carcinoma.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18839319 2009 Src activity alters alpha3 integrin expression in colon tumor cells.
18695939 2008 Overexpression of HAb18G/CD147 promotes invasion and metastasis via alpha3beta1 integrin mediated FAK-paxillin and FAK-PI3K-Ca2+ pathways.
18550570 2008 Polymorphisms in predicted microRNA-binding sites in integrin genes and breast cancer: ITGB4 as prognostic marker.
18492066 2008 The tetraspanin CD151 regulates cell morphology and intracellular signaling on laminin-511.
18464290 2008 Alphavbeta3 and alphavbeta5 integrins control glioma cell response to ionising radiation through ILK and RhoB.
18384059 2008 Association analysis of schizophrenia on 18 genes involved in neuronal migration: MDGA1 as a new susceptibility gene.
18224668 2008 Diagnostic value of integrin alpha3, beta4, and beta5 gene expression levels for the clinical outcome of tongue squamous cell carcinoma.
17997226 2008 Changes in adhesive and migratory characteristics of hepatocellular carcinoma (HCC) cells induced by expression of alpha3beta1 integrin.
17888902 2007 Laminin isoforms and their integrin receptors in glioma cell migration and invasiveness: Evidence for a role of alpha5-laminin(s) and alpha3beta1 integrin.
17630833 2007 Integrin-mediated host cell invasion by type 1-piliated uropathogenic Escherichia coli.
17498594 2007 Ameloblastoma and adenomatoid odontogenic tumor: the role of alpha2beta1, alpha3beta1, and alpha5beta1 integrins in local invasiveness and architectural characteristics.
17481915 2007 Effect of the alpha3beta1 integrin on the IL-1 stimulated activation of c-Jun N-terminal kinase (JNK) in CACO-2 cells.
17475774 2007 Inhibition of integrin-mediated crosstalk with epidermal growth factor receptor/Erk or Src signaling pathways in autophagic prostate epithelial cells induces caspase-independent death.
17265493 2007 Identification of markers to characterize and sort human articular chondrocytes with enhanced in vitro chondrogenic capacity.
16785564 2006 Identification of a TLR-independent pathway for Borrelia burgdorferi-induced expression of matrix metalloproteinases and inflammatory mediators through binding to integrin alpha 3 beta 1.
16732726 2006 The role of beta1 integrin subfamily in anchorage-dependent apoptosis of breast carcinoma cells differing in multidrug resistance.
16731529 2006 Integrin alpha3beta1, a novel receptor for alpha3(IV) noncollagenous domain and a trans-dominant Inhibitor for integrin alphavbeta3.
16707493 2006 Slug regulates integrin expression and cell proliferation in human epidermal keratinocytes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16571677 2006 A critical role for tetraspanin CD151 in alpha3beta1 and alpha6beta4 integrin-dependent tumor cell functions on laminin-5.
16537545 2006 Contrasting effects of EWI proteins, integrins, and protein palmitoylation on cell surface CD9 organization.
16510444 2006 Functional relevance of urinary-type plasminogen activator receptor-alpha3beta1 integrin association in proteinase regulatory pathways.
16475024 2005 Transforming growth factor-beta1 upregulates transcription of alpha3 integrin gene in hepatocellular carcinoma cells via Ets-transcription factor-binding motif in the promoter region.
16459165 2006 Reduced podocyte expression of alpha3beta1 integrins and podocyte depletion in patients with primary focal segmental glomerulosclerosis and chronic PAN-treated rats.
16390868 2006 E-cadherin loss promotes the initiation of squamous cell carcinoma invasion through modulation of integrin-mediated adhesion.
16373174 2006 Characterization of the oligosaccharide component of alpha3beta1 integrin from human bladder carcinoma cell line T24 and its role in adhesion and migration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16339173 2006 Laminin-5-integrin interaction signals through PI 3-kinase and Rac1b to promote assembly of adherens junctions in HT-29 cells.
16307893 2006 Integrin alpha3beta1 suppresses long-term potentiation at inhibitory synapses on the cerebellar Purkinje neuron.
16273094 2005 RNA-dependent integrin alpha3 protein localization regulated by the Muscleblind-like protein MLP1.
16103120 2005 A specific microdomain ("glycosynapse 3") controls phenotypic conversion and reversion of bladder cancer cells through GM3-mediated interaction of alpha3beta1 integrin with CD9.
16055706 2005 The signaling network of transforming growth factor beta1, protein kinase Cdelta, and integrin underlies the spreading and invasiveness of gastric carcinoma cells.
15983209 2005 Role for beta1 integrin and its associated alpha3, alpha5, and alpha6 subunits in development of the human fetal pancreas.
15919367 alpha3beta1 integrin induced suppression of the Caco-2 epithelial cell IL-1 signaling pathway leading to NF-(kappa)B activation.
15878864 2005 Kaposi's sarcoma-associated herpesvirus activation of vascular endothelial growth factor receptor 3 alters endothelial function and enhances infection.
15805105 2005 Beta ig-h3 induces keratinocyte differentiation via modulation of involucrin and transglutaminase expression through the integrin alpha3beta1 and the phosphatidylinositol 3-kinase/Akt signaling pathway.
15677332 2005 Potentiation of the ligand-binding activity of integrin alpha3beta1 via association with tetraspanin CD151.
15611341 2004 Palmitoylation supports assembly and function of integrin-tetraspanin complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361064 2005 The disintegrin domain of ADAM9: a ligand for multiple beta1 renal integrins.
15351855 2004 Prognosis of young ischemic stroke in Taiwan: impact of prothrombotic genetic polymorphisms.
15346842 2004 Association of genetic polymorphisms in the fibrinogen and platelet glycoprotein genes with unstable angina in Chinese patients.
15302884 2004 The cAMP-Epac-Rap1 pathway regulates cell spreading and cell adhesion to laminin-5 through the alpha3beta1 integrin but not the alpha6beta4 integrin.
15280429 2004 Alpha 3 beta 1 integrin promotes keratinocyte cell survival through activation of a MEK/ERK signaling pathway.
15254262 2004 Cross-talk of integrin alpha3beta1 and tissue factor in cell migration.
15194015 2004 Effect of glycoprotein IIIa PlA2 polymorphism on outcome of patients with stable coronary artery disease and effect of smoking.
15181153 2004 NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin.
15109703 2004 Platelet GPIaC807T polymorphism is associated with negative outcome of sudden hearing loss.
15024036 2004 Tumor cell alpha3beta1 integrin and vascular laminin-5 mediate pulmonary arrest and metastasis.
14706682 2004 Genetic polymorphisms associated with thrombophilia and vascular disease in women with unexplained late intrauterine fetal death: a multicenter study.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676841 2004 Tetraspanin CD81 is linked to ERK/MAPKinase signaling by Shc in liver tumor cells.
14666169 2001 Endometrial receptivity: expression of alpha3beta1, alpha4beta1 and alphaVbeta1 endometrial integrins in women with impaired fertility.
14662754 2003 EWI-2 regulates alpha3beta1 integrin-dependent cell functions on laminin-5.
14645603 2003 Integrin alpha3beta1 is an alternative cellular receptor for adenovirus serotype 5.
14612440 2004 Recombinant human laminin-5 domains. Effects of heterotrimerization, proteolytic processing, and N-glycosylation on alpha3beta1 integrin binding.
14607975 2003 Characterization of the ligand-binding specificities of integrin alpha3beta1 and alpha6beta1 using a panel of purified laminin isoforms containing distinct alpha chains.
14602071 2003 Recognition of the neural chemoattractant Netrin-1 by integrins alpha6beta4 and alpha3beta1 regulates epithelial cell adhesion and migration.
14596610 2003 Mass spectrometric based mapping of the disulfide bonding patterns of integrin alpha chains.
12919677 2003 The MSP receptor regulates alpha6beta4 and alpha3beta1 integrins via 14-3-3 proteins in keratinocyte migration.
12887919 2003 TIMP-2 mediated inhibition of angiogenesis: an MMP-independent mechanism.
12717361 2003 The alpha2 and alpha3 integrins are required for morphologic differentiation of an intestinal epithelial cell line.
12699087 Decreased expression of alpha3 and beta1 integrin subunits is responsible for differentiation-associated changes in cells behavior in terminally differentiated human oral keratinocytes.
12615788 2003 No evidence of association between prothrombotic gene polymorphisms and the development of acute myocardial infarction at a young age.
12480921 2002 Complementary DNA arrays identify CD63 tetraspanin and alpha3 integrin chain as differentially expressed in low and high metastatic human colon carcinoma cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12452046 2002 [Expression of integrin-alpha 3 mRNA in meningiomas and its biological significance].
12445830 2002 Identification and recombinant production of human laminin alpha4 subunit splice variants.
12397374 2002 Crucial role of fibroblasts in regulating epidermal morphogenesis.
12372459 2002 The alpha(2)beta(1) and alpha(3)beta(1) integrins do not mediate attachment of endometrial cells to peritoneal mesothelium.
11988844 Different phenotypes in human prostate cancer: alpha6 or alpha3 integrin in cell-extracellular adhesion sites.
11964076 2002 Regulation of melanoma cell migration and invasion by laminin-5 and alpha3beta1 integrin (VLA-3).
11936878 2001 Characterization of first trimester human fetal placental vessels using immunocytochemical markers.
11907260 2002 Palmitoylation of tetraspanin proteins: modulation of CD151 lateral interactions, subcellular distribution, and integrin-dependent cell morphology.
11884516 2002 Association of the tetraspanin CD151 with the laminin-binding integrins alpha3beta1, alpha6beta1, alpha6beta4 and alpha7beta1 in cells in culture and in vivo.
11853674 2002 Integrin alpha3beta1 (CD 49c/29) is a cellular receptor for Kaposi's sarcoma-associated herpesvirus (KSHV/HHV-8) entry into the target cells.
11679509 2001 Clomiphene citrate does not affect the secretion of alpha3, alphaV and beta1 integrin molecules during the implantation window in patients with unexplained infertility.
11387256 2001 Involvement of alpha3 integrin/tetraspanin complexes in the angiogenic response induced by angiotensin II.
11358957 2001 Conformational regulation of the fibronectin binding and alpha 3beta 1 integrin-mediated adhesive activities of thrombospondin-1.
11344212 2001 Identification of extracellular matrix components and their integrin receptors in the human fetal adrenal gland.
11327697 2001 Calreticulin is directly involved in anti-alpha3 integrin antibody-mediated secretion and activation of matrix metalloprotease-2.
11307375 2001 Expression of beta 1 integrins in human dental pulp in vivo: a comparative immunohistochemical study on healthy and chronic marginal periodontitis samples.
11278628 2001 Purification and characterization of human laminin-8. Laminin-8 stimulates cell adhesion and migration through alpha3beta1 and alpha6beta1 integrins.
11165569 2001 Patterns of integrin expression in a human mandibular explant model of osteoblast differentiation.
10994995 2000 Expression of integrin subunits correlates with differentiation of epithelial cell lineages in developing human gastric mucosa.
10982388 2000 Cell contact-dependent activation of alpha3beta1 integrin modulates endothelial cell responses to thrombospondin-1.
10929059 2000 Comparative analysis of integrin expression on monocyte-derived macrophages and monocyte-derived dendritic cells.
10906324 2000 The LIM-only protein DRAL/FHL2 binds to the cytoplasmic domain of several alpha and beta integrin chains and is recruited to adhesion complexes.
10852818 2000 Galectin-8 binding to integrins inhibits cell adhesion and induces apoptosis.
10811835 2000 The tetraspan molecule CD151, a novel constituent of hemidesmosomes, associates with the integrin alpha6beta4 and may regulate the spatial organization of hemidesmosomes.
10801807 2000 Structural requirement of carboxyl-terminal globular domains of laminin alpha 3 chain for promotion of rapid cell adhesion and migration by laminin-5.
10734060 2000 Direct extracellular contact between integrin alpha(3)beta(1) and TM4SF protein CD151.
10694273 2000 CD9 is expressed on human endometrial epithelial cells in association with integrins alpha(6), alpha(3) and beta(1).
10684262 2000 Tissue transglutaminase is an integrin-binding adhesion coreceptor for fibronectin.
10487289 1999 Ultrastructural localization of alpha-3 integrin subunit in malignant melanoma and adjacent epidermis.
10455171 1999 A novel protease-docking function of integrin at invadopodia.
10094488 1999 Identification of novel interaction partners for the conserved membrane proximal region of alpha-integrin cytoplasmic domains.
10082751 1999 Characterization of integrin expression in islets isolated from hamster, canine, porcine, and human pancreas.
10065872 1999 CD9 is expressed in extravillous trophoblasts in association with integrin alpha3 and integrin alpha5.
9950675 1999 A cell signal pathway involving laminin-5, alpha3beta1 integrin, and mitogen-activated protein kinase can regulate epithelial cell proliferation.
9809676 1998 Distribution of alpha3, alpha5 and alpha(v) integrin subunits in mature and immature human oocytes.
9733622 1998 Enhancement of metastatic activity of colon cancer as influenced by expression of cell surface antigens.
9704023 1998 Genomic organization of the human alpha 3 integrin subunit gene.
9402008 1997 Alternatively spliced variants: a new view of the integrin cytoplasmic domain.
9360996 1997 NAG-2, a novel transmembrane-4 superfamily (TM4SF) protein that complexes with integrins and other TM4SF proteins.
9360995 1997 Generation of monoclonal antibodies to integrin-associated proteins. Evidence that alpha3beta1 complexes with EMMPRIN/basigin/OX47/M6.
9350325 Localization of adhesion molecules on human spermatozoa by fluorescence microscopy.
9223324 1997 Tat protein induces self-perpetuating permissivity for productive HIV-1 infection.
9111516 1997 The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8757325 1996 Transmembrane-4 superfamily proteins CD81 (TAPA-1), CD82, CD63, and CD53 specifically associated with integrin alpha 4 beta 1 (CD49d/CD29).
8407358 1993 Integrins: cell adhesives and modulators of cell function.
8187758 1994 Molecular and biological characterization of fusion regulatory proteins (FRPs): anti-FRP mAbs induced HIV-mediated cell fusion via an integrin system.
8006073 1994 Cell attachment to extracellular matrix substrates is inhibited upon downregulation of expression of calreticulin, an intracellular integrin alpha-subunit-binding protein.
7591201 1995 Distribution of extracellular and cytoplasmic domains of the alpha 3 and alpha 6 integrin subunits in solid tumors.
7545357 1995 Appearance and distribution of laminin A chain isoforms and integrin alpha 2, alpha 3, alpha 6, beta 1, and beta 4 subunits in the developing human small intestinal mucosa.
7542504 1995 Human mast cells derived from fetal liver cells cultured with stem cell factor express a functional CD51/CD61 (alpha v beta 3) integrin.
6593709 1984 Somatic cell genetic analysis of human cell surface antigens: chromosomal assignments and regulation of expression in rodent-human hybrid cells.
3033641 1987 The very late antigen family of heterodimers is part of a superfamily of molecules involved in adhesion and embryogenesis.
1911778 1991 In vitro interaction of a polypeptide homologous to human Ro/SS-A antigen (calreticulin) with a highly conserved amino acid sequence in the cytoplasmic domain of integrin alpha subunits.
1714443 1991 Identification of human galactoprotein b3, an oncogenic transformation-induced membrane glycoprotein, as VLA-3 alpha subunit: the primary structure of human integrin alpha 3.
1655803 1991 Molecular cloning and expression of the cDNA for alpha 3 subunit of human alpha 3 beta 1 (VLA-3), an integrin receptor for fibronectin, laminin, and collagen.