Property Summary

NCBI Gene PubMed Count 123
PubMed Score 88.92
PubTator Score 126.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
colon cancer -1.400 2.9e-02
aldosterone-producing adenoma -1.438 3.0e-02
Astrocytoma, Pilocytic 1.100 6.2e-04
cystic fibrosis -1.322 2.4e-03
ductal carcinoma in situ -1.500 4.2e-05
group 3 medulloblastoma 1.200 6.8e-03
head and neck cancer -1.100 9.2e-03
intraductal papillary-mucinous adenoma (... -1.600 5.2e-03
intraductal papillary-mucinous carcinoma... -1.400 1.4e-02
invasive ductal carcinoma -1.700 1.3e-04
lung cancer -1.100 4.0e-03
malignant mesothelioma -4.300 4.0e-09
non-small cell lung cancer -1.399 5.1e-18
ovarian cancer -1.700 1.1e-08
pancreatic cancer 1.300 8.5e-03
posterior fossa group A ependymoma 1.100 3.2e-05
primary pancreatic ductal adenocarcinoma 1.637 1.1e-03
ulcerative colitis 1.100 2.8e-04

Protein-protein Interaction (1)

Gene RIF (63)

AA Sequence

MAPRPRARPGVAVACCWLLTVVLRCCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGKWVLIGSPLVG      1 - 70
QPKNRTGDVYKCPVGRGESLPCVKLDLPVNTSIPNVTEVKENMTFGSTLVTNPNGGFLACGPLYAYRCGH     71 - 140
LHYTTGICSDVSPTFQVVNSIAPVQECSTQLDIVIVLDGSNSIYPWDSVTAFLNDLLERMDIGPKQTQVG    141 - 210
IVQYGENVTHEFNLNKYSSTEEVLVAAKKIVQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVT    211 - 280
DGESHDNHRLKKVIQDCEDENIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVT    281 - 350
IVKTLGERIFALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKASQIIIPRNTT    351 - 420
FNVESTKKNEPLASYLGYTVNSATASSGDVLYIAGQPRYNHTGQVIIYRMEDGNIKILQTLSGEQIGSYF    421 - 490
GSILTTTDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQMSLEPIKQTCCSSRQHNSCTT    491 - 560
ENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHGGAVYIYHGSGKTIRKEYAQRIPSGGDGKTL    561 - 630
KFFGQSIHGEMDLNGDGLTDVTIGGLGGAALFWSRDVAVVKVTMNFEPNKVNIQKKNCHMEGKETVCINA    631 - 700
TVCFDVKLKSKEDTIYEADLQYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQ    701 - 770
DSVRITLDFNLTDPENGPVLDDSLPNSVHEYIPFAKDCGNKEKCISDLSLHVATTEKDLLIVRSQNDKFN    771 - 840
VSLTVKNTKDSAYNTRTIVHYSPNLVFSGIEAIQKDSCESNHNITCKVGYPFLRRGEMVTFKILFQFNTS    841 - 910
YLMENVTIYLSATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYHISIAANETVPEVINSTEDIG    911 - 980
NEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPTGLSSSENANCRPHIFEDPFSINSGKKMTTS    981 - 1050
TDHLKRGTILDCNTCKFATITCNLTSSDISQVNVSLILWKPTFIKSYFSSLNLTIRGELRSENASLVLSS   1051 - 1120
SNQKRELAIQISKDGLPGRVPLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK              1121 - 1179
//

Text Mined References (128)

PMID Year Title