Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.19
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.0e-06
malignant mesothelioma 3232 5.9e-06
lung cancer 4740 7.8e-04
psoriasis 6694 1.2e-03
astrocytic glioma 2597 2.4e-02
ependymoma 4679 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Distal arthrogryposis 42 4.102 2.1

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.100 2.4e-02
ependymoma 1.100 4.1e-02
lung cancer 1.500 7.8e-04
malignant mesothelioma 1.300 5.9e-06
osteosarcoma -2.060 1.0e-06
psoriasis -1.400 1.2e-03

Gene RIF (1)

AA Sequence

MRSVSYVQRVALEFSGSLFPHAICLGDVDNDTLNELVVGDTSGKVSVYKNDDSRPWLTCSCQGMLTCVGV      1 - 70
GDVCNKGKNLLVAVSAEGWFHLFDLTPAKVLDASGHHETLIGEEQRPVFKQHIPANTKVMLISDIDGDGC     71 - 140
RELVVGYTDRVVRAFRWEELGEGPEHLTGQLVSLKKWMLEGQVDSLSVTLGPLGLPELMVSQPGCAYAIL    141 - 210
LCTWKKDTGSPPASEGPTDGSRETPAARDVVLHQTSGRIHNKNVSTHLIGNIKQGHGTESSGSGLFALCT    211 - 280
LDGTLKLMEEMEEADKLLWSVQVDHQLFALEKLDVTGNGHEEVVACAWDGQTYIIDHNRTVVRFQVDENI    281 - 350
RAFCAGLYACKEGRNSPCLVYVTFNQKIYVYWEVQLERMESTNLVKLLETKPEYHSLLQELGVDPDDLPV    351 - 420
TRALLHQTLYHPDQPPQCAPSSLQDPT                                               421 - 447
//

Text Mined References (9)

PMID Year Title