Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.71
PubTator Score 6.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -1.100 4.1e-06
astrocytic glioma -1.500 7.4e-03
ependymoma -1.500 8.9e-03
glioblastoma -2.300 2.2e-05
oligodendroglioma -1.200 1.1e-11
osteosarcoma -1.177 9.4e-03
atypical teratoid / rhabdoid tumor -2.200 1.6e-05
medulloblastoma -1.400 1.0e-03
medulloblastoma, large-cell -2.600 5.2e-04
primitive neuroectodermal tumor -1.300 2.6e-03
pancreatic ductal adenocarcinoma liver m... -1.669 1.0e-02
intraductal papillary-mucinous adenoma (... 1.700 4.6e-04
intraductal papillary-mucinous carcinoma... 1.500 2.9e-03
intraductal papillary-mucinous neoplasm ... 1.700 1.2e-03
Parkinson's disease -1.100 4.6e-02
Breast cancer 2.300 4.5e-02
adult high grade glioma -1.800 1.7e-03
lung carcinoma 1.100 7.8e-28
Alzheimer's disease -1.400 3.0e-02
Pick disease -1.900 7.2e-05
ovarian cancer -2.100 4.9e-07
pituitary cancer 1.100 1.0e-03

Synonym

Accession Q8TB96 Q96SR4 Q9BRE2 Q9H2V9 Protein TIP
Symbols TIP
CDA08
LNKN-1
2310047C21Rik

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Pathway (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17384681 Alterations in the cellular levels of TIP influence the phosphorylation state of a specific protein substrate of ataxia-telangiectasia mutated (ATM)/ATM- and Rad3-related (ATR) kinases.

AA Sequence

MAAAGRLPSSWALFSPLLAGLALLGVGPVPARALHNVTAELFGAEAWGTLAAFGDLNSDKQTDLFVLRER      1 - 70
NDLIVFLADQNAPYFKPKVKVSFKNHSALITSVVPGDYDGDSQMDVLLTYLPKNYAKSELGAVIFWGQNQ     71 - 140
TLDPNNMTILNRTFQDEPLIMDFNGDLIPDIFGITNESNQPQILLGGNLSWHPALTTTSKMRIPHSHAFI    141 - 210
DLTEDFTADLFLTTLNATTSTFQFEIWENLDGNFSVSTILEKPQNMMVVGQSAFADFDGDGHMDHLLPGC    211 - 280
EDKNCQKSTIYLVRSGMKQWVPVLQDFSNKGTLWGFVPFVDEQQPTEIPIPITLHIGDYNMDGYPDALVI    281 - 350
LKNTSGSNQQAFLLENVPCNNASCEEARRMFKVYWELTDLNQIKDAMVATFFDIYEDGILDIVVLSKGYT    351 - 420
KNDFAIHTLKNNFEADAYFVKVIVLSGLCSNDCPRKITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQ    421 - 490
SAHLALQLPYNVLGLGRSANFLDHLYVGIPRPSGEKSIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLY    491 - 560
LTPSNIVLLTAIALIGVCVFILAIIGILHWQEKKADDREKRQEAHRFHFDAM                      561 - 612
//

Text Mined References (9)

PMID Year Title
25437307 2014 LINKIN, a new transmembrane protein necessary for cell adhesion.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17384681 2007 Identification of a PP2A-interacting protein that functions as a negative regulator of phosphatase activity in the ATM/ATR signaling pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12598909 2003 TIP, a T-cell factor identified using high-throughput screening increases survival in a graft-versus-host disease model.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.