Property Summary

NCBI Gene PubMed Count 12
PubMed Score 237.14
PubTator Score 270.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 5.300 1.9e-09
osteosarcoma -2.812 5.9e-12
ependymoma 1.700 9.4e-11
medulloblastoma 1.800 2.0e-05
cystic fibrosis -1.305 4.8e-06
atypical teratoid / rhabdoid tumor 2.900 3.2e-09
glioblastoma -1.500 5.6e-06
medulloblastoma, large-cell -1.700 4.6e-06
primitive neuroectodermal tumor 2.200 9.1e-04
adult high grade glioma -1.600 1.1e-04
non primary Sjogren syndrome sicca 1.500 1.3e-02
lung adenocarcinoma 1.300 1.0e-05
spina bifida 1.261 4.1e-02
ovarian cancer 1.300 3.9e-04

Gene RIF (3)

PMID Text
23902760 analysis of how myo-inositol-3-phosphate synthase is regulated by phosphorylation
22707096 MIP synthase expressed in developing fetal liver and shows optima pH between 7.0 and 7.5.
15464731 Upregulation occurs through the interaction of several low-affinity E2F binding motifs present in the minimal promoter.

AA Sequence

MEAAAQFFVESPDVVYGPEAIEAQYEYRTTRVSREGGVLKVHPTSTRFTFRTARQVPRLGVMLVGWGGNN      1 - 70
GSTLTAAVLANRLRLSWPTRSGRKEANYYGSLTQAGTVSLGLDAEGQEVFVPFSAVLPMVAPNDLVFDGW     71 - 140
DISSLNLAEAMRRAKVLDWGLQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD    141 - 210
IRDFRSSAGLDKVIVLWTANTERFCEVIPGLNDTAENLLRTIELGLEVSPSTLFAVASILEGCAFLNGSP    211 - 280
QNTLVPGALELAWQHRVFVGGDDFKSGQTKVKSVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFR    281 - 350
SKEVSKSNVVDDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDS    351 - 420
LLAAPIMLDLALLTELCQRVSFCTDMDPEPQTFHPVLSLLSFLFKAPLVPPGSPVVNALFRQRSCIENIL    421 - 490
RACVGLPPQNHMLLEHKMERPGPSLKRVGPVAATYPMLNKKGPVPAATNGCTGDANGHLQEEPPMPTT      491 - 558
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23902760 2013 Phosphorylation regulates myo-inositol-3-phosphate synthase: a novel regulatory mechanism of inositol biosynthesis.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
22707096 2012 L-myo-inositol-1-phosphate synthase expressed in developing organ: isolation and characterisation of the enzyme from human fetal liver.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
17988368 2007 Human MIP synthase splice variants in bipolar disorder.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17901568 Effect of valproate derivatives on human brain myo-inositol-1-phosphate (MIP) synthase activity and amphetamine-induced rearing.
17121280 2006 Mammalian inositol 3-phosphate synthase: its role in the biosynthesis of brain inositol and its clinical use as a psychoactive agent.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15464731 2004 E2F1 regulation of the human myo-inositol 1-phosphate synthase (ISYNA1) gene promoter.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15024000 2004 Human 1-D-myo-inositol-3-phosphate synthase is functional in yeast.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12941308 2003 cDNA cloning and gene expression analysis of human myo-inositol 1-phosphate synthase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.