Property Summary

NCBI Gene PubMed Count 8
PubMed Score 42.02
PubTator Score 7.37

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
active ulcerative colitis -1.022 2.5e-02
psoriasis -2.100 3.4e-07

Gene RIF (6)

AA Sequence

MCAEVGPALCRGMERNSLGCCEAPKKLSLSFSIEAILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKP      1 - 70
PKDQPQEGRKSKRRVRTTFTTEQLHELEKIFHFTHYPDVHIRSQLAARINLPEARVQIWFQNQRAKWRKQ     71 - 140
EKIGNLGAPQQLSEASVALPTNLDVAGPTWTSTALRRLAPPTSCCPSAQDQLASAWFPAWITLLPAHPWE    141 - 210
TQPVPGLPIHQTCIPVLCILPPPHPKWGSICATST                                       211 - 245
//

Text Mined References (11)

PMID Year Title