1. Home
  2. Targets
  3. IST1 homolog

Tbio IST1 homolog

ESCRT-III-like protein involved in specific functions of the ESCRT machinery. Is required for efficient abscission during cytokinesis, but not for HIV-1 budding. The involvement in the MVB pathway is not established. Involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells (PubMed:19129479, PubMed:19129480). During late anaphase, involved in nuclear envelope reassembly and mitotic spindle disassembly together with the ESCRT-III complex: IST1 acts by mediating the recruitment of SPAST to the nuclear membrane, leading to microtubule severing (PubMed:26040712). Regulates early endosomal tubulation together with the ESCRT-III complex by mediating the recruitment of SPAST (PubMed:23897888).

This gene encodes a protein with MIT-interacting motifs that interacts with components of endosomal sorting complexes required for transport (ESCRT). ESCRT functions in vesicle budding, such as that which occurs during membrane abscission in cytokinesis. There is a pseudogene for this gene on chromosome 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012]

 Comments

Property Summary

NCBI Gene PubMed Count 45
PubMed Score 0.00
PubTator Score 26.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.3e-08
osteosarcoma 7933 3.5e-05
medulloblastoma, large-cell 6234 3.7e-04
glioblastoma 5572 1.2e-03
astrocytoma 1493 2.3e-02
breast carcinoma 1614 2.4e-02

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.517 3.5e-05
astrocytoma 1.300 2.3e-02
glioblastoma -1.100 1.2e-03
medulloblastoma, large-cell -1.200 3.7e-04
breast carcinoma 1.100 2.4e-02
ovarian cancer -1.500 2.3e-08

Synonym

Accession P53990 A8KAH5 J3QLU7 Q3SYM4 Q9BQ81 Q9BWN2 hIST1
Symbols OLC1

Gene

IST1

PDB

3FRR   3FRS   3JC1   4U7E   4U7I   4U7Y   4WZX  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

 UniProt Keyword (11)

See all...

 GO Function (4)

 GO Component (9)

 GO Process (12)

See all...

 Compartment GO Term (2)

 HCA RNA Cell Line (56)

See all...

Pathway (5)

Protein-protein Interaction (1)

CHMP1A  

Gene RIF (16)

PMID Text
26011858 Structural and biochemical studies reveal an unusually tight interaction between ULK3 and IST1, an ESCRT-III subunit required for cytokinetic abscission.
25657007 Crystal structures of three molecular complexes reveal that IST1 binds to the MIT domains of VPS4 and LIP5.
24880589 Findings indicate that a high expression level of overexpressed in lung cancer 1 (OLC1) serves as a biomarker for poor prognosis for breast cancer, suggesting that OLC1 may be a potential target of antiangiogenic therapy for breast cancer.
24608342 Overexpression of OLC1 promotes tumorigenesis of human esophageal squamous cell carcinoma.
24403489 Over-expression of the OCL1 is associated with colorectal cancer.
23897888 The results suggest that inclusion of IST1 into the ESCRT complex allows recruitment of spastin to promote fission of recycling tubules from the endosome.
23649269 the binding of ALG-2 to IST1 is Ca(2+)-dependent
23609236 OLC1 over-expression is an important factor in epithelial ovarian carcinoma prognosis and can be a potential biomarker for ovarian carcinoma.
21616915 The interaction between CL7MIT and CHMP1B and between CL7MIT and IST1 became stronger when IST1 or CHMP1B was additionally coexpressed, suggesting formation of ternary complex of calpain-7, IST1 and CHMP1B.
21439932 These results demonstrate that cigarette smoke regulates OLC1 expression in lung cancer cells by compromising its ubiquitination and subsequent degradation through the ubiquitin E3 ligase APC.
20849418 Results demonstrate that human calpain 7 is proteolytically active, and imply that calpain 7 is activated by ESCRT-III-related protein IST1.
20719964 These data suggest that Ist1 interaction is important for spartin recruitment to the midbody and that spartin participates in cytokinesis.
19525971 Data show that the N-terminal core domains of increased sodium tolerance-1 (IST1) and charged multivesicular body protein-3 (CHMP3) form equivalent four-helix bundles, revealing that IST1 is a previously unrecognized ESCRT-III family member.
19129480 hIST1 is essential for cytokinesis in mammalian cells.
19129479 IST1 and CHMP1 act together to recruit and modulate specific VPS4 activities required during the final stages of cell division.
19001599 OLC1 (KIAA0174) is a candidate oncogene in lung cancer whose expression may be regulated by exposure to cigarette smoke.

AA Sequence 

MLGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAME      1 - 70
ILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQ     71 - 140
IGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPGVETDLIDVGFTDDVKKGGPG    141 - 210
RGGSGGFTAPVGGPDGTVPMPMPMPMPSANTPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSY    211 - 280
ESVDDINADKNISSAQIVGPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDF    281 - 350
DDLSRRFEELKKKT                                                            351 - 364
//

Text Mined References (51)

PMID Year Title
26040712 2015 Spastin and ESCRT-III coordinate mitotic spindle disassembly and nuclear envelope sealing.
26011858 2015 ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins.
25657007 2015 Distinct mechanisms of recognizing endosomal sorting complex required for transport III (ESCRT-III) protein IST1 by different microtubule interacting and trafficking (MIT) domains.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24953135 2014 Involvement of calpain-7 in epidermal growth factor receptor degradation via the endosomal sorting pathway.
24880589 2014 OLC1 is overexpressed in breast cancer and its expression correlates with poor patient survival.
24608342 2014 Overexpression of OLC1 promotes tumorigenesis of human esophageal squamous cell carcinoma.
24403489 2014 Over-expression of the overexpressed in lung cancer-1 is associated with poor prognosis in colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23897888 2013 An ESCRT-spastin interaction promotes fission of recycling tubules from the endosome.
23649269 2013 Mammalian ESCRT-III-related protein IST1 has a distinctive met-pro repeat sequence that is essential for interaction with ALG-2 in the presence of Ca2+.
23609236 2013 Over-expression of the overexpressed in lung cancer 1 is associated with poor prognosis in epithelial ovarian cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23045692 2012 ESCRT-III binding protein MITD1 is involved in cytokinesis and has an unanticipated PLD fold that binds membranes.
23015756 2012 MITD1 is recruited to midbodies by ESCRT-III and participates in cytokinesis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22340600 2012 Differential requirements of mammalian ESCRTs in multivesicular body formation, virus budding and cell division.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21706489 2011 Influence of whole arm loss of chromosome 16q on gene expression patterns in oestrogen receptor-positive, invasive breast cancer.
21616915 2011 Calpain-7 binds to CHMP1B at its second ?-helical region and forms a ternary complex with IST1.
21557262 2011 Proteomic identification of exosomal LRG1: a potential urinary biomarker for detecting NSCLC.
21439932 2011 Cigarette smoke suppresses the ubiquitin-dependent degradation of OLC1.
21269460 2011 Initial characterization of the human central proteome.
20849418 2010 Autolytic activity of human calpain 7 is enhanced by ESCRT-III-related protein IST1 through MIT-MIM interaction.
20719964 2010 SPG20 protein spartin is recruited to midbodies by ESCRT-III protein Ist1 and participates in cytokinesis.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19525971 2009 Structural basis for ESCRT-III protein autoinhibition.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19129480 2009 Essential role of hIST1 in cytokinesis.
19129479 2009 Biochemical analyses of human IST1 and its function in cytokinesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19001599 2008 Overexpression of OLC1, cigarette smoke, and human lung tumorigenesis.
19001597 2008 Defining a candidate lung cancer gene.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.