Property Summary

NCBI Gene PubMed Count 11
PubMed Score 15.44
PubTator Score 12.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
medulloblastoma, large-cell -1.100 5.4e-05
Atopic dermatitis -1.400 2.4e-03
primary pancreatic ductal adenocarcinoma 1.448 1.0e-02
intraductal papillary-mucinous adenoma (... -2.000 4.1e-03
intraductal papillary-mucinous carcinoma... -1.700 1.1e-02
pancreatic cancer 1.400 1.4e-02
breast carcinoma -2.000 2.9e-30
psoriasis -1.300 2.4e-06
Breast cancer -4.000 2.1e-35
ductal carcinoma in situ -1.300 1.3e-02
invasive ductal carcinoma -2.300 2.9e-03
ovarian cancer 3.400 3.2e-03

Gene RIF (3)

PMID Text
24956034 Given that ISM1 has been reported to have anti-angiogenic properties, these observations suggest that ISM1 is a mediator of lymphocyte effector functions and may participate in both innate and acquired immune responses.
23333304 HIV-1 Vif upregulates the expression of isthmin 1, angiogenesis inhibitor (ISM1) in Vif-expression T cells
21544092 Isthmin unexpectedly has both a pro-survival and death-promoting effect on endothelial cells depending on its physical state.

AA Sequence

MVRLAAELLLLLGLLLLTLHITVLRGSGAADGPDAAAGNASQAQLQNNLNVGSDTTSETSFSLSKEAPRE      1 - 70
HLDHQAAHQPFPRPRFRQETGHPSLQRDFPRSFLLDLPNFPDLSKADINGQNPNIQVTIEVVDGPDSEAD     71 - 140
KDQHPENKPSWSVPSPDWRAWWQRSLSLARANSGDQDYKYDSTSDDSNFLNPPRGWDHTAPGHRTFETKD    141 - 210
QPEYDSTDGEGDWSLWSVCSVTCGNGNQKRTRSCGYACTATESRTCDRPNCPGIEDTFRTAATEVSLLAG    211 - 280
SEEFNATKLFEVDTDSCERWMSCKSEFLKKYMHKVMNDLPSCPCSYPTEVAYSTADIFDRIKRKDFRWKD    281 - 350
ASGPKEKLEIYKPTARYCIRSMLSLESTTLAAQHCCYGDNMQLITRGKGAGTPNLISTEFSAELHYKVDV    351 - 420
LPWIICKGDWSRYNEARPPNNGQKCTESPSDEDYIKQFQEAREY                              421 - 464
//

Text Mined References (11)

PMID Year Title
25952901 2015 Isthmin is a novel vascular permeability inducer that functions through cell-surface GRP78-mediated Src activation.
24956034 2014 Isthmin 1 is a secreted protein expressed in skin, mucosal tissues, and NK, NKT, and th17 cells.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
21544092 2011 Isthmin exerts pro-survival and death-promoting effect on endothelial cells through alphavbeta5 integrin depending on its physical state.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
19874420 2011 Isthmin is a novel secreted angiogenesis inhibitor that inhibits tumour growth in mice.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12128218 2002 Isthmin is a novel secreted protein expressed as part of the Fgf-8 synexpression group in the Xenopus midbrain-hindbrain organizer.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.