Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.65
PubTator Score 3.13

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
ductal carcinoma in situ 1.100 9.2e-04
glioblastoma 1.100 9.3e-03
group 3 medulloblastoma 1.300 1.2e-03
invasive ductal carcinoma 1.300 2.6e-05
lung cancer 1.100 5.6e-03
medulloblastoma, large-cell 1.100 1.0e-03
osteosarcoma 2.634 1.6e-06
ovarian cancer 1.600 6.2e-03
psoriasis 3.400 1.9e-05

Gene RIF (2)

AA Sequence

MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGT      1 - 70
WKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKS     71 - 140
SQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDV    141 - 210
LYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLT    211 - 280
RDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNP    281 - 350
PTD                                                                       351 - 353
//

Text Mined References (13)

PMID Year Title