Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.65
PubTator Score 3.13

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 3.400 1.9e-05
osteosarcoma 2.634 1.6e-06
glioblastoma 1.100 9.3e-03
medulloblastoma, large-cell 1.100 1.0e-03
lung cancer 1.700 2.4e-04
group 3 medulloblastoma 1.300 1.2e-03
ductal carcinoma in situ 1.100 9.2e-04
invasive ductal carcinoma 1.300 2.6e-05
ovarian cancer 1.600 6.2e-03

Gene RIF (2)

PMID Text
18976975 Knockdown of interferon stimulated exonuclease gene 20kDa-like 2 (ISG20L2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18065403 ISG20L2 is a 3' to 5' exoribonuclease involved in ribosome biogenesis at the level of 5.8 S rRNA maturation, more specifically in the processing of the 12 S precursor rRNA.

AA Sequence

MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGT      1 - 70
WKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKS     71 - 140
SQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDV    141 - 210
LYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLT    211 - 280
RDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNP    281 - 350
PTD                                                                       351 - 353
//

Text Mined References (13)

PMID Year Title
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22540864 2012 Proteomic characterization of the human FTSJ3 preribosomal complexes.
21269460 2011 Initial characterization of the human central proteome.
21036379 2011 Antiviral activities of ISG20 in positive-strand RNA virus infections.
19060904 2009 An empirical framework for binary interactome mapping.
18065403 2008 ISG20L2, a novel vertebrate nucleolar exoribonuclease involved in ribosome biogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.