Property Summary

NCBI Gene PubMed Count 126
PubMed Score 301.77
PubTator Score 246.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (31)

Disease log2 FC p
systemic lupus erythematosus 2.100 4.2e-05
Multiple myeloma 2.077 8.4e-03
malignant mesothelioma 2.100 2.8e-06
Barrett's esophagus 2.100 4.1e-02
esophageal adenocarcinoma 2.400 1.8e-02
psoriasis 2.700 1.6e-06
cutaneous lupus erythematosus 5.100 2.5e-06
glioblastoma multiforme 1.300 1.4e-07
group 4 medulloblastoma -2.000 1.1e-05
medulloblastoma, large-cell -2.200 5.2e-05
juvenile dermatomyositis 5.252 1.7e-30
Atopic dermatitis 1.500 3.4e-03
tuberculosis 1.500 1.3e-02
pancreatic ductal adenocarcinoma liver m... 2.348 4.6e-02
intraductal papillary-mucinous neoplasm ... 2.300 2.3e-02
active Crohn's disease 1.295 8.0e-03
active ulcerative colitis 1.435 2.6e-02
pancreatic cancer 1.900 4.1e-05
breast carcinoma 2.200 1.2e-24
Multiple Sclerosis 2.900 1.7e-02
interstitial cystitis 1.500 6.9e-04
cystic fibrosis 2.200 1.1e-03
pilocytic astrocytoma 1.100 7.1e-03
posterior fossa group A ependymoma 1.100 1.9e-02
primary Sjogren syndrome 1.800 7.6e-03
subependymal giant cell astrocytoma 2.821 2.3e-02
lung adenocarcinoma 1.400 5.8e-04
invasive ductal carcinoma 2.300 3.4e-03
inflammatory breast cancer 3.100 1.1e-03
ovarian cancer 3.300 3.5e-05
dermatomyositis 3.200 7.2e-03

 GO Function (1)

Gene RIF (107)

PMID Text
26763998 This study shows that interferon-stimulated gene 15 (ISG15) lowers Human respiratory syncytial virus growth through protein ISGylation.
26617815 ISG15 might serve as a novel prognostic biomarker in drinkers with esophageal squamous cell cancer
26563749 ISG15 is elevated in viremic HIV-1 patients and is associated with high TRAIL and IDO levels.
26560068 Data show the induction of signal transducer and activator of transcription (STAT)1 and IFN-stimulated gene 15 protein (ISG15) in Rickettsia conorii-infected human umbilical vein endothelial cells (HUVECs).
26361997 The inhibitory effect of ISG15 on HCV RNA replication does not require its conjugation to substrates by HERC5.
26259872 These data reveal a previously uncharacterized ISG15-dependent restriction of Listeria infection, reinforcing the view that ISG15 is a key component of the innate immune response.
26226047 Cellular ubiquitin is a substrate of ISG15 and Lys 29 on ubiquitin is the major ISG15 acceptor site.
26116899 HIV-1 Vpr upregulates the expression of ISG15 in human monocyte-derived dendritic cells
26036210 Microparticles released from Mycobacterium tuberculosis-infected human macrophages contain increased levels of the type I interferon inducible protein ISG15.
25906440 that ISGylation of BECN1 at Lys117, as well as Lys263, Lys265, and Lys266 serve an important role in negative regulation of intracellular processes including autophagy
25905045 Reovirus T3D infection induced STAT-1, ISG-15, IFIT-1, Mx1, and IFIT-3 expression.
25749047 free ISG15 may have antitumor and immunoregulatory function in vivo in breast cancer
25429107 ISG15 conjugation marks proteins for interaction with HDAC6 and p62 upon forced stressful conditions likely as a step toward autophagic clearance
25368022 our work demonstrates that ISG15 is a previously unrecognized support factor for CSC in the PDAC microenvironment with a key role in pathogenesis and progression.
25307056 intracellular ISG15 is IFN-alpha/beta-inducible not to serve as a substrate for ISGylation-dependent antiviral immunity, but to ensure USP18-dependent regulation of IFN-alpha/beta and prevention of IFN-alpha/beta-dependent autoinflammation
25252956 HIV-1 Vpr upregulates the expression of ISG15 in human monocyte-derived dendritic cells
25238261 Results suggest that high ISG15 expression is an intrinsic feature of hepatocellular carcinoma and a trigger for tumorigenesis and metastasis.
25170834 HIV-1 Vpr upregulates the expression of ISG15 in human monocyte-derived dendritic cells
25165091 The ISG15 conjugation system represents a critical innate response mechanism in cardiomyocytes to fight the battle against invading pathogens, limiting inflammatory cardiomyopathy, heart failure, and death.
24844324 Propose that Isg15-dependent degradation of p53 represents an alternative mechanism of controlling p53 protein levels, and, thus, it is an attractive pathway for drug discovery.
24768535 Results showed that ISG15 modification (ISGylation) of PCNA plays a key role in translesion DNA synthesis termination.
24742347 HIV-1 Vpr upregulates the expression of ISG15 in human monocyte-derived dendritic cells
24452380 suppression of ISG15 by siRNA sensitized A549-CUG2 cells to vesicular stomatitis virus infection.
24386835 HIV-1 infection up-regulating expression of ISG15 in cell lines.
24300530 ISG15 is a potential prognostic marker in high-grade serous carcinoma of the ovary
24257616 ISG15 is counteracted by vaccinia virus E3 protein and controls the proinflammatory response against viral infection.
24237697 These data support the interferon-induced generation of a Tsg101- and ISG15-dependent checkpoint in the secretory pathway that compromises influenza virus release.
24056783 expression of the ISG15 and/or ISGylation system attenuates HIF-1alpha-mediated gene expression and tumorigenic growth.
24024201 Our results suggest that ISG15 overexpression could be developed into a powerful gene-therapeutic tool for treating IFN-alpha-resistant HCC.
23750257 ISG15 does not appear to play a key role in IFN-beta-mediated C2C12 myoblast cell fusion
23588721 High interferon-stimulated gene ISG-15 expression affects HCV treatment outcome in patients co-infected with HIV and HCV.
23318454 Findings support the development of ISG15 conjugation inhibitors for treating breast and also other cancers expressing oncogenic Ki-Ras.
23229543 Activation of double-stranded RNA-activated protein kinase (PKR) by interferon-stimulated gene 15 (ISG15) modification down-regulates protein translation
23212917 ISG15 deregulates autophagy in genotoxin-treated ataxia telangiectasia cells
22859821 ISG15 plays an essential role as an IFN-gamma-inducing secreted molecule for optimal antimycobacterial immunity.
22762019 HIV-1 Vpr upregulates the expression of ISG15 in human monocyte-derived dendritic cells
22740306 ISG15, is likely to be associated with both dysgenesis and tumorigenesis and may be a potential prognostic marker for oral cancer
22729740 TNF-alpha elicits the induction of ISG15 and ISG15 conjugates not only via the autocrine stimulation of type I interferon expression, but also through a type I interferon-independent pathway.
22706304 ISG15 as a tumor suppressor via its conjugation to a tp63 splice variant
22647704 HIV-1 Vpr upregulates the expression of ISG15 in human monocyte-derived dendritic cells
22405323 HIV-1 Vpr upregulates the expression of ISG15 in human monocyte-derived dendritic cells
22185919 results suggest that the aberrant activation of the ISG15 pathway confers a motile phenotype to breast cancer cells by disrupting cell architecture and stabilizing proteins involved in cell motility, invasion and metastasis
22100648 Inhibition of R. conorii-induced ISG15 by RNA interference results in significant increase in the extent of rickettsial replication, whereas UBP43 knockdown yields a reciprocal inhibitory effect.
22093708 The E3 ligase activity of HERC5 was required for blocking HIV-1 Gag particle production and correlated with the post-translational modification of Gag with ISG15.
22093708 HIV-1 Vpr upregulates the expression of ISG15 in human monocyte-derived dendritic cells
21994560 HIV-1 Vpr upregulates the expression of ISG15 in human monocyte-derived dendritic cells
21808041 influenza B virus NS1B-N-terminal region of NS1B binding of ISG15 is responsible for the inhibition of interferon-induced ISG15 conjugation in cells
21757684 analysis of the crystal structure of human ISG15 protein in complex with influenza B virus NS1B
21544738 Report of nearly complete backbone (1)H(N), (15)N, (13)C', and (13)C(alpha), as well as side chain (13)C(beta), methyl (Ile-delta1, Leu, Val), amide (Asn, Gln), and indole N-H (Trp) NMR resonance assignments for the 157-residue human ISG15 protein.
21399617 Study report that USP21 cleaves Ub polymers, and with reduced activity also targets ISG15, but is inactive against NEDD8.
21298066 expression of the ISG15 is elevated in A-T cells derived from various A-T patients, as well as in brain tissues derived from the ATM knockout mice and A-T patients, suggesting that ATM negatively regulates the ISG15 pathway
21245344 Structural basis for the removal of ubiquitin and interferon-stimulated gene 15 by a viral ovarian tumor domain-containing protease
20946978 In addition to cellular ISGylation targets, recent reports implicate viral proteins as targets of ISG15 modification; these studies provide fresh insights into the antiviral mechanisms of ISG15.[Review]
20639253 data indicate that the interferon stimulated gene 15, which is induced by HCV-mediated activation of the innate immune system, is a proviral factor that plays an important role in the pathogenesis of HCV.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20542004 Data suggest that, in the context of an interferon-stimulated cell, newly translated viral proteins may be primary targets of ISG15.
20308324 This study characterizes HERC5 as a positive regulator of innate antiviral responses, and show that it sustains IRF3 activation via a novel posttranslational modification, ISG15-ylation.
20219937 The authors demonstrate that influenza B virus NS1 protein potently antagonizes human but not mouse ISGylation, a property dependent on B/NS1 binding the N-terminal domain of human but not mouse ISG15.
20164219 Thus, there appear to be multiple levels of ISG15-induced inhibition acting at different stages of the retrovirus release process.
20164219 HIV-1 Vpr upregulates the expression of ISG15 in human monocyte-derived dendritic cells
20157543 Upregulation of ISG15 with telomere shortening may contribute to chronic inflammatory states associated with human aging.
20133869 NS1 protein of influenza A virus (NS1A protein), an essential, multifunctional protein, is ISG15 modified in virus-infected cells.
20093371 NS1B protein exhibits species-specific binding; it binds human and non-human primate ISG15 but not mouse or canine ISG15
20035788 ISG15 over-expression in human medulloblastoma cells significantly reduced the Japanese encephalitis virus -induced cytopathic effect and inhibited virus replication by reducing the viral titers and genomes.
19959962 Data demonstrated that ISG15 is one of the genes associated with intrinsic gemcitabine sensitivity.
19956859 ISG15 is involved in cell growth and survival of prostate cancer
19913121 Observational study of gene-disease association. (HuGE Navigator)
19846672 ISG15 promotes hepatitis C virus production.
19694548 HIV-1 Vpr upregulates the expression of ISG15 in human monocyte-derived dendritic cells
19656964 These results reveal a novel function for ISG15 in the regulation of the IFN-alpha pathway and its antihepatitis C effect.
19430494 study describes the modulation of androgen receptor expression by ISGylation components, which affects the proliferation of prostate cancer cells, thereby providing evidence for a novel function of the ISGylation system in malignant transformation
19378789 regulates immune response. (review)
19357168 Inhibition of influenza A virus gene expression by ISG15 conjugation in human cells is sufficient to result in inhibition of virus replication at early times of infection.
19074853 UBE1L-ISG15 preferentially inhibits cyclin D1 in lung cancer
19073728 Kinetic analysis revealed that mutation of arginine 153 to alanine (R153A) in ISG15 ablated hISG15-hUbE1L binding and transthiolation of UbcH8.
19043203 expression of the ISG15 system suppresses NF-kappaB activation
18953482 Observational study of gene-disease association. (HuGE Navigator)
18627608 ISG15 is overexpressed in breast carcinoma cells compared with normal breast tissue, both at the RNA and protein level
18606809 nitrosylation of ISG15 enhances target protein ISGylation
18597038 Observational study of gene-disease association. (HuGE Navigator)
18583345 Ube1L was required for transfer of ISG15 to UbcH8 and for binding of Ube1L to UbcH8
18566215 These results suggest that ISG15, which interferes with proteasome-mediated repair of TOP1-DNA covalent complexes, is a potential tumor biomarker.
18356159 N-terminal ubiquitin-like domain of ISG15 mainly functions in the ligation step and Influenza B virus NS1 protein inhibits ISGylation by competing with E3 ligases for binding to the N-terminal domain
18305167 These data provide evidence of antiviral activity of ISG15 against Ebola virus and suggest a mechanism of action involving disruption of Nedd4 function and subsequent ubiquitination of VP40.
18287095 a mechanistically novel function of ISG15 in the enhancement of the innate anti-viral response through specific inhibition of Nedd4 Ub-E3 activity
17692280 Our results demonstrate that SARS-CoV PLpro can differentiate between ubiquitin-like modifiers sharing a common C-terminal sequence, and that the debranching activity of the PLpro is linkage type selective.
17653289 ISG15 is a newcomer among ubiquitin-like molecules and utilizes the conjugating but also the deconjugating machinery of its more established relative ubiquitin.
17289916 ISGylation (by ISG15) of 4EHP may play an important role in cap structure-dependent translation control in immune responses.
17222803 Thus we propose that autoISGylation of EFP negatively regulates its ISG15 E3 ligase activity for 14-3-3sigma.
17097911 review evidence of a role for ISG15 as an endogenous tumor suppressor that, when dysregulated in malignant cells, can be subverted to promote oncogenesis
17069755 Efp protein could be conjugated with not only ubiquitin but also ISG15.
16884686 Four candidate target proteins were demonstrated to be ISGylated in UBE1L- and UbcH8-dependent manners
16641915 Higher levels of ISG15 protein is associated with muscle-invasive bladder cancer
16434471 ISG15 is the critical component in IFN-mediated inhibition of HIV-1 release
16428300 isolated ISG15-modified and unmodified UbcH6 proteins, and analyzed their abilities to form thioester intermediates with ubiquitin
16424026 results suggest that the ISG15 pathway, which is deregulated during tumorigenesis, negatively regulates the ubiquitin/proteasome pathway by interfering with protein polyubiquitination/degradation
16139798 These data indicate that ISGylation targets proteins found in several fundamentally important cellular pathways and will contribute to understanding the physiologic role of interferon-induced ISG15 and ISG15 conjugation.
16122702 identify Lys92 as the only ISG15 modification site in Ubc13, which is the first report about the ISG15 modification site
16009940 ISG15 conjugation targets both IFN-induced and constitutively expressed proteins functioning in diverse cellular pathways.
15917233 The three-dimensional structure of recombinant ISG15C78S was determined at 2.4-A resolution.The docking model predicts side-chain interactions that presumably define the specificity between the ubiquitin and ISG15 ligation pathways
15684817 ISG15 is induced by camptothecin in human tumor cells
15670748 Quantitative-PCR and Northern analysis confirmed down-regulation of UCRP and UBE2L6 with BRCA2 knockdown, respectively.
14976209 RA treatment of APL and other RA-responsive leukemic cells induced expression of UBE1L and ISG15 as well as intracellular ISG15 conjugates. A physical association was found between UBE1L and ISG15 in vivo.
12539042 HIV-1 Vpr upregulates the expression of ISG15 in human monocyte-derived dendritic cells
12067988 Interferon stimulated gene 15 constitutively produced by melanoma cells induces e-cadherin expression on human dendritic cells.
12055236 The ISG15 gene contains a unique interferon-stimulated response element that enables the binding and recruiting not only of interferon regulatory factors but also of PU.1.

AA Sequence

MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGST      1 - 70
VLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEY     71 - 140
GLKPLSTVFMNLRLRGGGTEPGGRS                                                 141 - 165
//

Text Mined References (139)

PMID Year Title
26763998 2016 ISG15 Is Upregulated in Respiratory Syncytial Virus Infection and Reduces Virus Growth through Protein ISGylation.
26617815 2015 Prognostic value of ISG15 mRNA level in drinkers with esophageal squamous cell cancers.
26563749 2016 ISG15 expression correlates with HIV-1 viral load and with factors regulating T cell response.
26560068 2016 Endothelial Cell Proteomic Response to Rickettsia conorii Infection Reveals Activation of the Janus Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT)-Inferferon Stimulated Gene (ISG)15 Pathway and Reprogramming Plasma Membrane Integrin/Cadherin Signaling.
26361997 2015 Inhibition of hepatitis C virus RNA replication by ISG15 does not require its conjugation to protein substrates by the HERC5 E3 ligase.
26259872 2015 ISG15 counteracts Listeria monocytogenes infection.
26226047 2015 Identification and characterization of a novel ISG15-ubiquitin mixed chain and its role in regulating protein homeostasis.
26036210 2015 Microparticles released from Mycobacterium tuberculosis-infected human macrophages contain increased levels of the type I interferon inducible proteins including ISG15.
25906440 2015 Modification of BECN1 by ISG15 plays a crucial role in autophagy regulation by type I IFN/interferon.
25905045 2015 Comparative proteomic analyses demonstrate enhanced interferon and STAT-1 activation in reovirus T3D-infected HeLa cells.
25749047 2015 Free ISG15 triggers an antitumor immune response against breast cancer: a new perspective.
25429107 2015 Interferon-stimulated gene 15 (ISG15) and ISG15-linked proteins can associate with members of the selective autophagic process, histone deacetylase 6 (HDAC6) and SQSTM1/p62.
25416956 2014 A proteome-scale map of the human interactome network.
25368022 2014 ISG15 is a critical microenvironmental factor for pancreatic cancer stem cells.
25307056 2015 Human intracellular ISG15 prevents interferon-?/? over-amplification and auto-inflammation.
25238261 2014 Interferon-stimulated gene 15 (ISG15) is a trigger for tumorigenesis and metastasis of hepatocellular carcinoma.
25165091 2014 Ubiquitin-like protein ISG15 (interferon-stimulated gene of 15 kDa) in host defense against heart failure in a mouse model of virus-induced cardiomyopathy.
24992036 2014 G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.
24844324 2014 Isg15 controls p53 stability and functions.
24768535 2014 Modification of PCNA by ISG15 plays a crucial role in termination of error-prone translesion DNA synthesis.
24452380 2014 Suppression of autophagic genes sensitizes CUG2-overexpressing A549 human lung cancer cells to oncolytic vesicular stomatitis virus-induced apoptosis.
24386835 2013 [HIV-1 infection up-regulating expression of interferon-stimulated gene 15 in cell lines].
24300530 2014 Interferon-stimulated gene, 15 kDa (ISG15) in ovarian high-grade serous carcinoma: prognostic impact and link to NF-?B pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24257616 2014 ISG15 is counteracted by vaccinia virus E3 protein and controls the proinflammatory response against viral infection.
24237697 2013 Type I interferon imposes a TSG101/ISG15 checkpoint at the Golgi for glycoprotein trafficking during influenza virus infection.
24056783 2013 A negative feedback of the HIF-1? pathway via interferon-stimulated gene 15 and ISGylation.
24024201 2013 ISG15 inhibits IFN-?-resistant liver cancer cell growth.
23750257 2013 Type 1 interferons inhibit myotube formation independently of upregulation of interferon-stimulated gene 15.
23588721 2013 High interferon-stimulated gene ISG-15 expression affects HCV treatment outcome in patients co-infected with HIV and HCV.
23579383 2013 ISG15: leading a double life as a secreted molecule.
23414970 2013 Interferon-induced ISG15 pathway: an ongoing virus-host battle.
23318454 2014 ISGylation governs the oncogenic function of Ki-Ras in breast cancer.
23229543 2013 Activation of double-stranded RNA-activated protein kinase (PKR) by interferon-stimulated gene 15 (ISG15) modification down-regulates protein translation.
23212917 2013 ISG15 deregulates autophagy in genotoxin-treated ataxia telangiectasia cells.
22964713 2013 ISG15 regulates IFN-? immunity in human mycobacterial disease.
22906767 2012 IFNs, ISGylation and cancer: Cui prodest?
22859821 2012 Mycobacterial disease and impaired IFN-? immunity in humans with inherited ISG15 deficiency.
22740306 2013 Gene expression changes in initiation and progression of oral squamous cell carcinomas revealed by laser microdissection and oligonucleotide microarray analysis.
22729740 2012 Up-regulation of interferon-stimulated gene15 and its conjugates by tumor necrosis factor-? via type I interferon-dependent and -independent pathways.
22706304 2012 Chemosensitivity is controlled by p63 modification with ubiquitin-like protein ISG15.
22693631 2012 Covalent protein modification with ISG15 via a conserved cysteine in the hinge region.
22666250 2012 Budding of Enveloped Viruses: Interferon-Induced ISG15-Antivirus Mechanisms Targeting the Release Process.
22185919 2012 ISG15 disrupts cytoskeletal architecture and promotes motility in human breast cancer cells.
22100648 2011 Rickettsia conorii infection stimulates the expression of ISG15 and ISG15 protease UBP43 in human microvascular endothelial cells.
22093708 2011 Human HERC5 restricts an early stage of HIV-1 assembly by a mechanism correlating with the ISGylation of Gag.
21994614 2010 Antiviral Properties of ISG15.
21808041 2011 Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus.
21757684 2011 Crystal structure of human ISG15 protein in complex with influenza B virus NS1B.
21544738 2011 Backbone and Ile-?1, Leu, Val methyl 1H, 13C and 15N NMR chemical shift assignments for human interferon-stimulated gene 15 protein.
21543490 2011 Mechanism of inhibition of retrovirus release from cells by interferon-induced gene ISG15.
21399617 2011 Polyubiquitin binding and cross-reactivity in the USP domain deubiquitinase USP21.
21298066 2011 A novel role for ATM in regulating proteasome-mediated protein degradation through suppression of the ISG15 conjugation pathway.
21269460 2011 Initial characterization of the human central proteome.
21245344 2011 Structural basis for the removal of ubiquitin and interferon-stimulated gene 15 by a viral ovarian tumor domain-containing protease.
21190487 2011 Interferon-stimulated gene 15 and the protein ISGylation system.
20946978 2010 Emerging role of ISG15 in antiviral immunity.
20639253 2010 The interferon stimulated gene 15 functions as a proviral factor for the hepatitis C virus and as a regulator of the IFN response.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20542004 2010 The ISG15 conjugation system broadly targets newly synthesized proteins: implications for the antiviral function of ISG15.
20308324 2010 Positive regulation of interferon regulatory factor 3 activation by Herc5 via ISG15 modification.
20219937 2010 Species-specific antagonism of host ISGylation by the influenza B virus NS1 protein.
20164219 2010 The interferon-induced gene ISG15 blocks retrovirus release from cells late in the budding process.
20157543 2009 Telomere length regulates ISG15 expression in human cells.
20153823 2010 ISG15 and immune diseases.
20133869 2010 ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells.
20093371 2010 Species specificity of the NS1 protein of influenza B virus: NS1 binds only human and non-human primate ubiquitin-like ISG15 proteins.
20035788 2010 ISG15 over-expression inhibits replication of the Japanese encephalitis virus in human medulloblastoma cells.
19959962 2010 Identifying molecular markers for chemosensitivity to gemcitabine in pancreatic cancer: increased expression of interferon-stimulated gene 15 kd is associated with intrinsic chemoresistance.
19956859 2010 The ubiquitin-like molecule interferon-stimulated gene 15 is overexpressed in human prostate cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19846672 2010 ISG15, a ubiquitin-like interferon-stimulated gene, promotes hepatitis C virus production in vitro: implications for chronic infection and response to treatment.
19680460 2009 Antiviral activity of innate immune protein ISG15.
19656964 2009 Modulation of alpha interferon anti-hepatitis C virus activity by ISG15.
19430494 2009 Expression, regulation and function of the ISGylation system in prostate cancer.
19378789 2009 [Regulation of immune response by ubiquitin-like molecule ISG15].
19357168 2009 Interferon-induced ISG15 conjugation inhibits influenza A virus gene expression and replication in human cells.
19270716 2009 ISG15 modification of filamin B negatively regulates the type I interferon-induced JNK signalling pathway.
19074853 2008 UBE1L causes lung cancer growth suppression by targeting cyclin D1.
19073728 2009 ISG15 Arg151 and the ISG15-conjugating enzyme UbE1L are important for innate immune control of Sindbis virus.
19043203 2008 Regulation of the nuclear factor (NF)-kappaB pathway by ISGylation.
18953482 2008 Polymorphisms of interferons and their receptors in the genetics of severe RSV-associated diseases.
18627608 2008 The ubiquitin-like molecule interferon-stimulated gene 15 (ISG15) is a potential prognostic marker in human breast cancer.
18606809 2008 Nitrosylation of ISG15 prevents the disulfide bond-mediated dimerization of ISG15 and contributes to effective ISGylation.
18597038 2009 High resolution linkage and linkage disequilibrium analyses of chromosome 1p36 SNPs identify new positional candidate genes for low bone mineral density.
18583345 2008 The basis for selective E1-E2 interactions in the ISG15 conjugation system.
18566215 2008 ISG15 as a novel tumor biomarker for drug sensitivity.
18356159 2008 Different roles for two ubiquitin-like domains of ISG15 in protein modification.
18305167 2008 ISG15 inhibits Ebola VP40 VLP budding in an L-domain-dependent manner by blocking Nedd4 ligase activity.
18287095 2008 ISG15 inhibits Nedd4 ubiquitin E3 activity and enhances the innate antiviral response.
18057259 2008 Negative feedback regulation of RIG-I-mediated antiviral signaling by interferon-induced ISG15 conjugation.
17692280 2007 Selectivity in ISG15 and ubiquitin recognition by the SARS coronavirus papain-like protease.
17653289 2007 Screen for ISG15-crossreactive deubiquitinases.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17289916 2007 ISG15 modification of the eIF4E cognate 4EHP enhances cap structure-binding activity of 4EHP.
17222803 2007 Negative regulation of ISG15 E3 ligase EFP through its autoISGylation.
17097911 2006 The interferon regulated ubiquitin-like protein, ISG15, in tumorigenesis: friend or foe?
17069755 2006 A ubiquitin E3 ligase Efp is up-regulated by interferons and conjugated with ISG15.
16884686 2006 Identification and Herc5-mediated ISGylation of novel target proteins.
16872604 2006 Negative regulation of protein phosphatase 2Cbeta by ISG15 conjugation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16641915 2006 Stage-associated overexpression of the ubiquitin-like protein, ISG15, in bladder cancer.
16434471 2006 Innate antiviral response targets HIV-1 release by the induction of ubiquitin-like protein ISG15.
16428300 2005 Link between the ubiquitin conjugation system and the ISG15 conjugation system: ISG15 conjugation to the UbcH6 ubiquitin E2 enzyme.
16424026 2006 Elevated expression of ISG15 in tumor cells interferes with the ubiquitin/26S proteasome pathway.
16254333 2005 Identification of interferon-stimulated gene 15 as an antiviral molecule during Sindbis virus infection in vivo.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16139798 2005 Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.
16122702 2005 ISG15 modification of ubiquitin E2 Ubc13 disrupts its ability to form thioester bond with ubiquitin.
16112642 2005 ISG15 modification of Ubc13 suppresses its ubiquitin-conjugating activity.
16009940 2005 Human ISG15 conjugation targets both IFN-induced and constitutively expressed proteins functioning in diverse cellular pathways.
15917233 2005 Crystal structure of the interferon-induced ubiquitin-like protein ISG15.
15684817 2004 Camptothecin induces the ubiquitin-like protein, ISG15, and enhances ISG15 conjugation in response to interferon.
15670748 2005 Down-regulation of UCRP and UBE2L6 in BRCA2 knocked-down human breast cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15131269 2004 The UbcH8 ubiquitin E2 enzyme is also the E2 enzyme for ISG15, an IFN-alpha/beta-induced ubiquitin-like protein.
14976209 2004 Involvement of UBE1L in ISG15 conjugation during retinoid-induced differentiation of acute promyelocytic leukemia.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11788588 2002 UBP43 (USP18) specifically removes ISG15 from conjugated proteins.
11157743 2001 Influenza B virus NS1 protein inhibits conjugation of the interferon (IFN)-induced ubiquitin-like ISG15 protein.
10866800 2000 Proteome analysis reveals ubiquitin-conjugating enzymes to be a new family of interferon-alpha-regulated genes.
10508226 1999 Ubiquitin cross-reactive protein gene expression is increased in decidualized endometrial stromal cells at the initiation of pregnancy.
10476939 1999 Oral use of interferon-alpha stimulates ISG-15 transcription and production by human buccal epithelial cells.
8892645 1996 In vitro and in vivo secretion of human ISG15, an IFN-induced immunomodulatory cytokine.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8550581 1996 Conjugation of the 15-kDa interferon-induced ubiquitin homolog is distinct from that of ubiquitin.
7526157 1994 Conjugates of ubiquitin cross-reactive protein distribute in a cytoskeletal pattern.
7490683 1995 Immunohistochemical localization of ubiquitin cross-reactive protein in human tissues.
3476954 1987 Interferon-induced transcription of a gene encoding a 15-kDa protein depends on an upstream enhancer element.
3350799 1988 A 15-kDa interferon-induced protein is derived by COOH-terminal processing of a 17-kDa precursor.
3087979 1986 Molecular characterization of the interferon-induced 15-kDa protein. Molecular cloning and nucleotide and amino acid sequence.
2477469 1989 A 15-kD interferon-induced protein and its 17-kD precursor: expression in Escherichia coli, purification, and characterization.
2440890 1987 Interferon induces a 15-kilodalton protein exhibiting marked homology to ubiquitin.
2005397 1991 IFN-induced 15-kDa protein is released from human lymphocytes and monocytes.
1695131 1990 Chromosomal localization of two human genes inducible by interferons, double-stranded RNA, and viruses.
1373138 1992 The interferon-inducible 15-kDa ubiquitin homolog conjugates to intracellular proteins.