Property Summary

NCBI Gene PubMed Count 7
PubMed Score 32.27
PubTator Score 1.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 5.5e-48
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 0.7
Disease Target Count Z-score Confidence
Obesity 678 3.535 1.8
Astigmatism 54 3.338 1.7
Cycloplegia 12 3.263 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 5.5e-48

AA Sequence

MSFPHFGHPYRGASQFLASASSSTTCCESTQRSVSDVASGSTPAPALCCAPYDSRLLGSARPELGAALGI      1 - 70
YGAPYAAAAAAQSYPGYLPYSPEPPSLYGALNPQYEFKEAAGSFTSSLAQPGAYYPYERTLGQYQYERYG     71 - 140
AVELSGAGRRKNATRETTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKM    141 - 210
TWAPKNKGGEERKAEGGEEDSLGCLTADTKEVTASQEARGLRLSDLEDLEEEEEEEEEAEDEEVVATAGD    211 - 280
RLTEFRKGAQSLPGPCAAAREGRLERRECGLAAPRFSFNDPSGSEEADFLSAETGSPRLTMHYPCLEKPR    281 - 350
IWSLAHTATASAVEGAPPARPRPRSPECRMIPGQPPASARRLSVPRDSACDESSCIPKAFGNPKFALQGL    351 - 420
PLNCAPCPRRSEPVVQCQYPSGAEAG                                                421 - 446
//

Text Mined References (8)

PMID Year Title