Property Summary

NCBI Gene PubMed Count 10
PubMed Score 33.42
PubTator Score 9.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Intellectual disability 998 0.0 4.0
Disease Target Count Z-score Confidence
Griscelli syndrome type 3 11 3.312 1.7
Disease Target Count
Hamamy Syndrome 1

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 3.000 3.0e-03
cystic fibrosis 1.127 1.1e-04
ductal carcinoma in situ 2.100 4.1e-03
ependymoma 1.800 5.0e-04
glioblastoma 3.300 1.2e-05
invasive ductal carcinoma 2.300 2.0e-02
lung adenocarcinoma 1.300 5.0e-02
malignant mesothelioma 2.900 3.2e-06
medulloblastoma 1.500 7.2e-03
medulloblastoma, large-cell 2.100 3.1e-02
osteosarcoma 2.007 1.2e-02
ovarian cancer -1.200 4.3e-05
pediatric high grade glioma 2.100 6.6e-04
primitive neuroectodermal tumor 2.100 3.3e-02

Gene RIF (4)

AA Sequence

MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPGYNSHLQYGAD      1 - 70
PAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNATRDATATLKAWLNEHRKNPY     71 - 140
PTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWTPRNRSEDEEEEENIDLEKNDEDEPQKPEDK    141 - 210
GDPEGPEAGGAEQKAASGCERLQGPPTPAGKETEGSLSDSDFKEPPSEGRLDALQGPPRTGGPSPAGPAA    211 - 280
ARLAEDPAPHYPAGAPAPGPHPAAGEVPPGPGGPSVIHSPPPPPPPAVLAKPKLWSLAEIATSSDKVKDG    281 - 350
GGGNEGSPCPPCPGPIAGQALGGSRASPAPAPSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNYGSFGH    351 - 420
LHGHPGPGPGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPYELKKGMSDI           421 - 483
//

Text Mined References (12)

PMID Year Title