Property Summary

NCBI Gene PubMed Count 9
PubMed Score 39.29
PubTator Score 31.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma 1.400 3.9e-02
posterior fossa group B ependymoma 2.600 7.7e-08
oligodendroglioma 1.900 6.4e-03
cystic fibrosis 2.996 2.4e-07
atypical teratoid / rhabdoid tumor 2.100 8.2e-03
glioblastoma 2.500 3.5e-04
medulloblastoma 1.600 1.3e-02
primitive neuroectodermal tumor 1.900 1.8e-02
adrenocortical carcinoma -1.347 1.1e-02
intraductal papillary-mucinous adenoma (... -2.900 1.5e-03
intraductal papillary-mucinous neoplasm ... -3.300 7.8e-03
breast carcinoma 1.400 4.8e-02
pediatric high grade glioma 2.000 9.4e-04
aldosterone-producing adenoma -1.051 9.6e-03
Endometriosis -1.295 3.2e-02
inflammatory breast cancer -1.400 5.7e-03
spina bifida -1.181 4.7e-02
ductal carcinoma in situ 1.500 1.1e-02
ovarian cancer 2.900 2.1e-04
pituitary cancer -1.300 5.4e-05

Gene RIF (4)

PMID Text
25512384 Strategies to pharmacologically regulate Irx3 function in adult endothelial cells may provide new therapies for angiogenesis.
24646999 data suggest that IRX3 is a functional long-range target of obesity-associated variants within FTO and represents a novel determinant of body mass and composition
20080751 IRX3 function may have a direct functional relationship to both obesity and type 2 diabetes.
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSFPQLGYQYIRPLYPSERPGAAGGSGGSAGARGGLGAGASELNASGSLSNVLSSVYGAPYAAAAAAAAA      1 - 70
QGYGAFLPYAAELPIFPQLGAQYELKDSPGVQHPAAAAAFPHPHPAFYPYGQYQFGDPSRPKNATRESTS     71 - 140
TLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRSRTDEEGNAYGSER    141 - 210
EEEDEEEDEEDGKRELELEEEELGGEEEDTGGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDL    211 - 280
GLGPISDSKNSDSEDSSEGLEDRPLPVLSLAPAPPPVAVASPSLPSPPVSLDPCAPAPAPASALQKPKIW    281 - 350
SLAETATSPDNPRRSPPGAGGSPPGAAVAPSALQLSPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGP    351 - 420
RLHPLSLLGSAPPHLLGLPGAAGHPAAAAAFARPAEPEGGTDRCSALEVEKKLLKTAFQPVPRRPQNHLD    421 - 490
AALVLSALSSS                                                               491 - 501
//

Text Mined References (9)

PMID Year Title
25512384 2015 The proangiogenic effect of iroquois homeobox transcription factor Irx3 in human microvascular endothelial cells.
24646999 2014 Obesity-associated variants within FTO form long-range functional connections with IRX3.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20080751 2010 Long-range gene regulation links genomic type 2 diabetes and obesity risk regions to HHEX, SOX4, and IRX3.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10370142 1999 Regulated expression patterns of IRX-2, an Iroquois-class homeobox gene, in the human breast.
9427753 1998 Xiro3 encodes a Xenopus homolog of the Drosophila Iroquois genes and functions in neural specification.