Property Summary

NCBI Gene PubMed Count 34
PubMed Score 0.00
PubTator Score 43.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 2.1e-22
lung carcinoma 2844 4.2e-07
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Boutonneuse fever 7 3.846 1.9
Exostosis 15 3.318 1.7

Protein-protein Interaction (1)

Gene RIF (24)

PMID Text
25631074 Cellular biotinylated insulin receptor substrate 4 (IRS4) is incorporated into HIV-1 Gag virus-like particles
25100728 The association of IRS4 with SSH1 contributes to localized activation of cofilin in membrane protrusions.
24039912 Overexpression of IRS4 in U2OS cells activates PI3K signalling.
22167131 This study clearly demonstrates associations between body mass index and IRS-4 variants in schizophrenia patients, but not in healthy controls, pointing to a possible involvement of IRS-4 in the control of body weight in schizophrenia.
21852217 We genotyped single-nucleotide polymorphisms of IGF1, IGF2, IGF1R, IGF2R, IGFBP1, IGFBP3, IGFBP5, IRS1, IRS2, and IRS in pancreatic cancer patients
21517825 Study for the first time identified IRS4 mutations in T-ALL.
21407155 IRS-4 gene is not of importance for aetiology of the vast majority of schizophrenia cases, but a single patient with schizophrenia and a mutation in IRS-4 points to that the insulin signalling system is of interest in the search for schizophrenia genes
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20416304 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20340132 The t(X;6) in subungual exostosis results in transcriptional deregulation of the gene for insulin receptor substrate 4.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19029952 The association and altered regulation of IRS proteins by Ad5E1A contribute to the adenovirus-transformed phenotype and modulates viral infection in an Akt-dependent manner.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18165436 Data demonstrate that IRS4 interacts with the LR. This recruitment is leptin dependent and requires phosphorylation of the Y1077 motif of the LR.
17965023 53BP2S interacts and modulates the insulin signals mediated by insulin receptor substrates.
17720279 Transgenic rat gene WDR6 interacts with insulin receptor substrate 4 (IRS-4) in the rat brain and may participate in signaling and regulation of feeding behavior and longevity in the brain.
17408801 IRS-4 plays an important role in HepG2 proliferation/differentiation and exerts its actions through ERK and p70S6K activation in a ras/raf/MEK1/2- and PI3Kinase/Akt-independent manner and in a PKC-dependent way
15870689 endogenous Brk and IRS-4 interact in A431 human epidermoid carcinoma cells
15331607 IRS-4 is subject to regulation by TNF-alpha, and PP4 mediates TNF-alpha-induced degradation of IRS-4
15316024 insulin receptor substrate-4 and ShcA have roles in signaling by the fibroblast growth factor receptor
15155816 data demonstrate cell-specific alterations in IRS protein concentrations in theca cells from polycystic ovaries consistent with exaggerated amplification of the insulin signal & which may play a role in ovarian hyperandrogenism & thecal hyperplasia
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12639902 IRS-4 does not function as a substrate of the insulin and the IGF-I receptor in primary muscle cells but may be involved in nonreceptor tyrosine kinase signaling.
11912194 Insulin receptor substrate 4 associates with the protein IRAS

AA Sequence

MASCSFTRDQATRRLRGAAAAAAAALAAVVTTPLLSSGTPTALIGTGSSCPGAMWLSTATGSRSDSESEE      1 - 70
EDLPVGEEVCKRGYLRKQKHGHRRYFVLKLETADAPARLEYYENARKFRHSVRAAAAAAAAAASGAAIPP     71 - 140
LIPPRRVITLYQCFSVSQRADARYRHLIALFTQDEYFAMVAENESEQESWYLLLSRLILESKRRRCGTLG    141 - 210
AQPDGEPAALAAAAAAEPPFYKDVWQVIVKPRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLL    211 - 280
SIRRCGHSEQYFFLEVGRSTVIGPGELWMQVDDCVVAQNMHELFLEKMRALCADEYRARCRSYSISIGAH    281 - 350
LLTLLSARRHLGLVPLEPGGWLRRSRFEQFCHLRAIGDGEDEMLFTRRFVTPSEPVAHSRRGRLHLPRGR    351 - 420
RSRRAVSVPASFFRRLAPSPARPRHPAEAPNNGARLSSEVSGSGSGNFGEEGNPQGKEDQEGSGGDYMPM    421 - 490
NNWGSGNGRGSGGGQGSNGQGSSSHSSGGNQCSGEGQGSRGGQGSNGQGSGGNQCSRDGQGTAGGHGSGG    491 - 560
GQRPGGGHGSGGGQGPGDGHGSGGGKNSGGGKGSGSGKGSDGDGERGKSLKKRSYFGKLTQSKQQQMPPP    561 - 630
PPPPPPPPPAGGTGGKGKSGGRFRLYFCVDRGATKECKEAKEVKDAEIPEGAARGPHRARAFDEDEDDPY    631 - 700
VPMRPGVATPLVSSSDYMPMAPQNVSASKKRHSRSPFEDSRGYMMMFPRVSPPPAPSPPKAPDTNKEDDS    701 - 770
KDNDSESDYMFMAPGAGAIPKNPRNPQGGSSSKSWSSYFSLPNPFRSSPLGQNDNSEYVPMLPGKFLGRG    771 - 840
LDKEVSYNWDPKDAASKPSGEGSFSKPGDGGSPSKPSDHEPPKNKAKRPNRLSFITKGYKIKPKPQKPTH    841 - 910
EQREADSSSDYVNMDFTKRESNTPAPSTQGLPDSWGIIAEPRQSAFSNYVNVEFGVPFPNPANDLSDLLR    911 - 980
AIPRANPLSLDSARWPLPPLPLSATGSNAIEEEGDYIEVIFNSAMTPAMALADSAIRYDAETGRIYVVDP    981 - 1050
FSECCMDISLSPSRCSEPPPVARLLQEEEQERRRPQSRSQSFFAAARAAVSAFPTDSLERDLSPSSAPAV   1051 - 1120
ASAAEPTLALSQVVAAASALAAAPGIGAAAAAAGFDSASARWFQPVANAADAEAVRGAQDVAGGSNPGAH   1121 - 1190
NPSANLARGDNQAGGAAAAAAAPEPPPRSRRVPRPPEREDSDNDDDTHVRMDFARRDNQFDSPKRGR      1191 - 1257
//

Text Mined References (38)

PMID Year Title
25100728 2014 Insulin receptor substrate-4 binds to Slingshot-1 phosphatase and promotes cofilin dephosphorylation.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24039912 2013 Effect of IRS4 levels on PI 3-kinase signalling.
22167131 2011 Association between body mass index and insulin receptor substrate-4 (IRS-4) gene polymorphisms in patients with schizophrenia.
21852217 2012 Insulin-like growth factor axis gene polymorphisms modify risk of pancreatic cancer.
21517825 2011 The insulin receptor substrate 4 gene (IRS4) is mutated in paediatric T-cell acute lymphoblastic leukaemia.
21407155 2011 The insulin receptor substrate-4 (IRS-4) gene and schizophrenia: no evidence for a main genetic factor, however one report of a single schizophrenia patient with a mutation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20416304 2010 Insulin-like growth factor axis gene polymorphisms and clinical outcomes in pancreatic cancer.
20340132 2011 The t(X;6) in subungual exostosis results in transcriptional deregulation of the gene for insulin receptor substrate 4.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19029952 2009 Adenovirus 5 E1A is responsible for increased expression of insulin receptor substrate 4 in established adenovirus 5-transformed cell lines and interacts with IRS components activating the PI3 kinase/Akt signalling pathway.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18165436 2008 Insulin receptor substrate 4 couples the leptin receptor to multiple signaling pathways.
17965023 2007 53BP2S, interacting with insulin receptor substrates, modulates insulin signaling.
17720279 2009 Identification and characterization of an insulin receptor substrate 4-interacting protein in rat brain: implications for longevity.
17408801 2007 Role of insulin receptor substrate-4 in IGF-I-stimulated HEPG2 proliferation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
15870689 2005 Interaction between Brk kinase and insulin receptor substrate-4.
15772651 2005 The DNA sequence of the human X chromosome.
15331607 2004 Protein phosphatase 4 interacts with and down-regulates insulin receptor substrate 4 following tumor necrosis factor-alpha stimulation.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15316024 2004 Tyrosine phosphoproteomics of fibroblast growth factor signaling: a role for insulin receptor substrate-4.
15155816 2004 Selective alterations in insulin receptor substrates-1, -2 and -4 in theca but not granulosa cells from polycystic ovaries.
12774026 2003 Insulin receptor substrate-4 signaling in quiescent rat hepatocytes and in regenerating rat liver.
12732844 2003 A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
12639902 2003 Insulin receptor substrate-4 is expressed in muscle tissue without acting as a substrate for the insulin receptor.
12052866 2002 SOCS-6 binds to insulin receptor substrate 4, and mice lacking the SOCS-6 gene exhibit mild growth retardation.
11912194 2002 Insulin receptor substrate 4 associates with the protein IRAS.
11316748 2001 The insulin-like growth factor I receptor-induced interaction of insulin receptor substrate-4 and Crk-II.
10594015 2000 IRS-4 mediates protein kinase B signaling during insulin stimulation without promoting antiapoptosis.
10531310 1999 Insulin receptor substrate-4 enhances insulin-like growth factor-I-induced cell proliferation.
9614078 1998 Interplay of the proto-oncogene proteins CrkL and CrkII in insulin-like growth factor-I receptor-mediated signal transduction.
9609109 1998 The IRS-signalling system: a network of docking proteins that mediate insulin action.
9553137 1998 Characterization of insulin receptor substrate 4 in human embryonic kidney 293 cells.
9261155 1997 A novel 160-kDa phosphotyrosine protein in insulin-treated embryonic kidney cells is a new member of the insulin receptor substrate family.