Property Summary

NCBI Gene PubMed Count 198
PubMed Score 414.65
PubTator Score 270.61

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma 1.400 2.7e-03
Atopic dermatitis -1.400 5.4e-04
atypical teratoid / rhabdoid tumor -1.300 4.3e-03
Breast cancer -2.000 1.4e-06
breast carcinoma -1.600 3.6e-32
chronic rhinosinusitis -1.235 4.1e-02
cutaneous lupus erythematosus -1.100 7.7e-03
ductal carcinoma in situ -2.300 5.7e-04
group 3 medulloblastoma -1.300 8.2e-04
interstitial lung disease -1.500 9.7e-03
intraductal papillary-mucinous carcinoma... 1.800 8.1e-03
invasive ductal carcinoma -2.400 2.6e-03
lung adenocarcinoma -1.900 4.8e-09
medulloblastoma, large-cell -2.500 9.7e-04
osteosarcoma -1.718 2.1e-02
psoriasis -1.600 2.6e-04
Rheumatoid arthritis 1.600 9.2e-03
subependymal giant cell astrocytoma -1.788 3.7e-03

Protein-protein Interaction (1)

Gene RIF (157)

AA Sequence

MASPPRHGPPGPASGDGPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGAGGDEATAGGGSAPQP      1 - 70
PRLEYYESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDEYFAVAAENEQEQEGWYRALT     71 - 140
DLVSEGRAAAGDAPPAAAPAASCSASLPGALGGSAGAAGAEDSYGLVAPATAAYREVWQVNLKPKGLGQS    141 - 210
KNLTGVYRLCLSARTIGFVKLNCEQPSVTLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVA    211 - 280
QNIHETILEAMKALKELFEFRPRSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAAT    281 - 350
PPAAKCSSCRVRTASEGDGGAAAGAAAAGARPVSVAGSPLSPGPVRAPLSRSHTLSGGCGGRGSKVALLP    351 - 420
AGGALQHSRSMSMPVAHSPPAATSPGSLSSSSGHGSGSYPPPPGPHPPLPHPLHHGPGQRPSSGSASASG    421 - 490
SPSDPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFYGYMTMDRPLSHCGRSYRRVS    491 - 560
GDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTLMRATFSGSAGRLCPSCPASSPKVAYHPYPE    561 - 630
DYGDIEIGSHRSSSSNLGADDGYMPMTPGAALAGSGSGSCRSDDYMPMSPASVSAPKQILQPRAAAAAAA    631 - 700
AVPSAGPAGPAPTSAAGRTFPASGGGYKASSPAESSPEDSGYMRMWCGSKLSMEHADGKLLPNGDYLNVS    701 - 770
PSDAVTTGTPPDFFSAALHPGGEPLRGVPGCCYSSLPRSYKAPYTCGGDSDQYVLMSSPVGRILEEERLE    771 - 840
PQATPGPSQAASAFGAGPTQPPHPVVPSPVRPSGGRPEGFLGQRGRAVRPTRLSLEGLPSLPSMHEYPLP    841 - 910
PEPKSPGEYINIDFGEPGARLSPPAPPLLASAASSSSLLSASSPASSLGSGTPGTSSDSRQRSPLSDYMN    911 - 980
LDFSSPKSPKPGAPSGHPVGSLDGLLSPEASSPYPPLPPRPSASPSSSLQPPPPPPAPGELYRLPPASAV    981 - 1050
ATAQGPGAASSLSSDTGDNGDYTEMAFGVAATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAF   1051 - 1120
LQASQPPDPHRGAKVIRADPQGGRRRHSSETFSSTTTVTPVSPSFAHNPKRHNSASVENVSLRKSSEGGV   1121 - 1190
GVGPGGGDEPPTSPRQLQPAPPLAPQGRPWTPGQPGGLVGCPGSGGSPMRRETSAGFQNGLNYIAIDVRE   1191 - 1260
EPGLPPQPQPPPPPLPQPGDKSSWGRTRSLGGLISAVGVGSTGGGCGGPGPGALPPANTYASIDFLSHHL   1261 - 1330
KEATIVKE                                                                 1331 - 1338
//

Text Mined References (209)

PMID Year Title