Property Summary

NCBI Gene PubMed Count 110
PubMed Score 273.32
PubTator Score 120.46

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma -1.065 8.2e-03
cutaneous lupus erythematosus 2.800 7.5e-04
esophageal adenocarcinoma 1.500 1.8e-02
head and neck cancer and chronic obstruc... 1.200 3.4e-03
interstitial cystitis 2.100 4.7e-03
intraductal papillary-mucinous neoplasm ... 1.600 1.8e-03
invasive ductal carcinoma 1.255 1.0e-02
lung adenocarcinoma -1.053 1.5e-04
lung cancer -2.800 5.1e-05
lung carcinoma -2.700 5.2e-26
non-small cell lung cancer -1.282 2.3e-11
osteosarcoma -2.616 3.7e-05
primary Sjogren syndrome 2.500 2.3e-04
psoriasis 1.100 3.7e-26
subependymal giant cell astrocytoma 1.645 1.2e-02
Waldenstrons macroglobulinemia -1.265 1.2e-02

Gene RIF (82)

AA Sequence

MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEG      1 - 70
DKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGR     71 - 140
SEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFY    141 - 210
YGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLL    211 - 280
HSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCF    281 - 350
GEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRE    351 - 420
NQQITV                                                                    421 - 426
//

Text Mined References (111)

PMID Year Title