Property Summary

NCBI Gene PubMed Count 103
PubMed Score 249.51
PubTator Score 120.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.265 1.2e-02
esophageal adenocarcinoma 1.500 1.8e-02
cutaneous lupus erythematosus 2.800 7.5e-04
osteosarcoma -2.616 3.7e-05
adrenocortical carcinoma -1.065 8.2e-03
non-small cell lung cancer -1.282 2.3e-11
intraductal papillary-mucinous neoplasm ... 1.600 1.8e-03
lung cancer -2.800 5.1e-05
interstitial cystitis 2.100 4.7e-03
primary Sjogren syndrome 2.500 2.3e-04
psoriasis 1.400 3.8e-08
subependymal giant cell astrocytoma 1.645 1.2e-02
invasive ductal carcinoma 1.255 1.0e-02
lung adenocarcinoma -1.053 1.5e-04
lung carcinoma -2.700 5.2e-26
head and neck cancer and chronic obstruc... 1.200 3.4e-03

Synonym

Accession Q02556 A0AV82 IRF-8
Symbols ICSBP
IRF-8
ICSBP1
IMD32A
IMD32B
H-ICSBP

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (2)

Gene RIF (75)

PMID Text
26613957 IRF5 and IRF8, two transcription factors with opposing functions, control TLR9 signaling in human plasmacytoid dendritic cells.
26563595 cytarabine-induced upregulation of the IRF8 in leukemic cells involves increased levels of ZNF224, which can counteract the repressive activity of WT1 on the IRF8-promoter
25989711 Results show that IRF8 is a possible genetic variant associated with the development of HT and production of thyroid antibody
25903733 This study demonstrated that the Polymorphism, Single Nucleotide of IRF8 is associated with multiple sclerosis in woman in Russia.
25880423 The IRF8 gene variant influenced the interaction between IRF8 and NF-kappaB and thus susceptibility to systemic sclerosis.
25749660 This article provides an overview of recent advances in our understanding of the role of IRF8 in myelopoiesis and related diseases. [review]
25453760 Irf8 forms a negative feedback loop with Cebpb, a monocyte-derived DC epigenetic fate-determining transcription factor.
25387409 Expression of WT1and IRF8 showed a moderate inverse correlation in acute myeloid leukemia patients. WT1 can be used as an minimal residual disease marker, especially in patients without recurrent genetic abnormalities.
25109451 Data demonstrate that IRF8 as a functional tumor suppressor is frequently methylated in RCC, and IRF8-mediated interferon signaling is involved in RCC pathogenesis.
24957708 MN1 prevents activation of the immune response pathway, and suggest restoration of IRF8 signaling as therapeutic target in AML
24943672 gene variants in IRF5, IRF8 and GPC5 were not associated with risk of relapse or disease progression in multiple sclerosis
24832596 Data demonstrate a novel function for ICSBP in epithelial-mesenchymal transition, cell motility, and invasion through the TGF-beta and Snail signaling pathways.
24753251 These data reveal a previously unrecognized BCR-ABL-STAT5-IRF-8 network, which widens the repertoire of potentially new anti-chronic myeloid leukemia targets.
24435047 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
24034601 The IRF8 gene polymorphisms might be associated with susceptibility to SLE.
23967110 the prognostic significance of IRF8 transcripts in other populations of AML patients
23775715 Using a capture sequencing strategy, we discovered the B-cell relevant genes IRF8, EBF1, and TNFSF13 as novel targets for IGH deregulation.
23661672 Coronary heart disease in systemic lupus erythematosus is associated with IRF8 gene variants.
23658517 novel insights into the contribution of EBNA3C to EBV-mediated B-cell transformation through regulation of IRF4 and IRF8 and add another molecular link to the mechanisms by which EBV dysregulates cellular activities
23573829 IRF8 is associated with germinal center B-cell-like type of diffuse large B-cell lymphoma and exceptionally involved in translocation t(14;16)(q32.33;q24.1).
23468103 IRF8 is required for ontogeny of the myeloid lineage and for host response to mycobacteria. The K108E & T80A mustations cause distinct forms of a novel primary immunodeficiency & associated susceptibility to mycobacteria. Review.
23308054 these results underscore a key role of IRF-8 in the cross talk between melanoma and immune cells, thus revealing its critical function within the tumor microenvironment in regulating melanoma progression and invasiveness.
23307532 A 3'UTR variant in IRF8 gene is associated with risk of chronic lymphocytic leukemia.
22994200 In a Korean population, there was no association of IRF8 polymorphisms, with inflammatory demyelinating diseases.
22942423 In resting macrophages, some IRF8 is conjugated to small ubiquitin-like modifiers (SUMO) 2/3 through the lysine residue 310. Macrophage activation prompts a reduction in SUMOylated IRF8.
22879909 The association of IRF1 and IRF8 variants with tuberculosis susceptibility was investigated.
22464253 Four additional susceptibility loci (IRF8, TMEM39A, IKZF3, and ZPBP2) for systemic lupus erythematosus were robustly established a multiethnic population (European, African American, Asian, Hispanic, Gullah, and Amerindian).
22262849 interaction between Tel and Tel-PdgfRbeta decreases Tel/Icsbp/Hdac3 binding to the PTPN13 cis element, resulting in increased transcription.
22096565 Data showed that IRF8 target genes contributes to multiple aspects of the biology of mature B cells including critical components of the molecular crosstalk among GC B cells, T follicular helper cells, and follicular dendritic cells.
22082370 [review] Induction of transcriptional repressors such as IRF8 is one of the mechanisms that inhibits osteoclastogenesis.
22046141 Association analysis identified five SLE susceptibility genes reaching genome-wide levels of significance : NCF2 ,IKZF1 ,IRF8 ,IFIH1 , and TYK2
22003407 IRF4 has activities similar to IRF8 in regulating myeloid cell development
21625229 study identifies a novel role for ICSBP in regulating cell growth via TGF-beta receptor upregulation and subsequent activation of the TGF-beta receptor/TAK-1/p38 pathway
21552549 association of single nucleotide polymorphisms to multiple sclerosis
21524210 We detected two distinct disease-causing mutations affecting interferon regulatory factor 8 (IRF8). Both mutations impair IRF8 transcriptional activity.
21487040 Findings determine the mechanism of IRF8 downregulation in CML cells.
21475251 The promoter was methylated in many MDS or AML patients. This may be the main mechanism of ICSBP inactivation in myeloid malignancies & may be functionally important for accumulation of chromosome aberrations during leukemic progression.
21228327 we propose a model for the rapid induction of IFN-beta in monocytes, whereby IRF8 and PU.1 form a scaffold complex on the IFN-beta promoter to facilitate the recruitment of IRF3
21220691 IRF-8 is a key player in the control of intracellular viral dsRNA-induced responses by a mechanism that negatively regulates Toll-like receptor (TLR)3 expression and can be exploited to block excessive TLR activation.
21216962 Positive regulatory domain I (PRDM1) and IRF8/PU.1 counter-regulate MHC class II transactivator (CIITA) expression during dendritic cell maturation.
21178004 IRF8 is required for normal development of marginal zone (MZ) and follicular B cells. Mice with a conventional knockout of Irf8 or a point mutation in the IRF association domain of IRF8 have increased numbers of MZ B cells.
21131588 independent association of 4 SNPs that met genome-wide statistical significance within the IRF8 gene in familial chronic lymphocytic leukemia
20980339 Observational study of gene-disease association. (HuGE Navigator)
20679491 Studies have identified a Gas2/calpain-dependent mechanism by which ICSBP influences beta-catenin activity in myeloid leukemia.
20634887 The chromatin modifications were determined at five PRC2 targets commonly underexpressed in multiple myeloma (CIITA, CXCL12, GATA2, CDH6 and ICSBP/IRF8). The selected genes were confirmed to be underexpressed in MM compared to normal plasma cells.
20573402 IRF8 and PU.1 can have both combined, and independent actions on different promoters in myeloid cells.
20435892 IL-27 p28 gene transcription is activated by interferon regulatory factor 8 in cooperation with interferon regulatory factor 1
20430450 Observational study of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19879194 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19865102 Observational study of gene-disease association. (HuGE Navigator)
19801548 Data identify the gene encoding Fanconi F (FANCF) as an ICSBP target gene.
19542426 Increased expression of IRF-8 in tumor-induced CD11b-positive/Gr-1-positive cells exerts an antitumor rather than protumorigenic effect in tumor-bearing IRF-8-transgenic hybrid mice.
19525953 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19525953 Replication in an independent set of 2,215 subjects with multiple sclerosis (MS) and 2,116 control subjects validates new MS susceptibility loci at TNFRSF1A, IRF8 and CD6; TNFRSF1A harbors two independent susceptibility alleles.
19074829 colon carcinoma cells silence IFN-gamma-activated IRF8 expression through MBD1-dependent and PIAS1-mediated inhibition of pSTAT1 function at the methylated IRF8 promoter
18922617 silencing of ICSBP/IRF8 expression, by DNA methylation or other epigenetic mechanisms, may be associated with the malignant phenotype of MM.
18701018 Pint mutations in patients with type 2 diabetes and their families were studied. mitochondrial genes including np3316, np3394 and np3426 in the ND1 region and np3243 in the tRNA(Leu(UUR))were screened.
18596738 Age-associated expression changes of IRF8 protein and mRNA levels in PB CD34+ cells
18580679 Suggest role for IRF8 during germinal center B-cell development and in related lymphomas, and provide a new diagnostic marker helpful in distinguishing B-cell non-Hodgkin lymphoma subtypes.
18469857 IRF8 was identified as a functional tumor suppressor, which is frequently silenced by epigenetic mechanism in multiple carcinomas
18316378 Dendritic cell priming by L. major infection results in the early activation of NF-kappaB transcription factors and the up-regulation and nuclear translocation of interferon regulatory factor 1 (IRF-1) and IRF-8.
18246201 activation of SHP2 protein tyrosine phosphatase synergized with ICSBP haploinsufficiency to facilitate cytokine-induced myeloproliferation, apoptosis resistance, and rapid progression to AML in a murine bone marrow transplantation model.
18195016 The interferon consensus sequence-binding protein (ICSBP/IRF8) represses PTPN13 gene transcription in differentiating myeloid cells
17687331 this CHRNA1 variant prevents binding of interferon regulatory factor 8 (IRF8) and abrogates CHRNA1 promoter activity in thymic epithelial cells in vitro
17386941 IRF8 is involved in a cooperative interaction with transcription factors Spi-1/PU.1 and non-tyrosine phosphorylated Stat1 in the formation of a pre-associated, poised complex for interleukin 1-beta gene induction.
17200120 IRF8 cooperates with PU.1 and IRF-2 to activate a composite ets/IRF-cis element in the NF1 promoter. The conserved IRF domain tyrosine in ICSBP/IRF8 is required for interaction with the DNA-bound PU.1-IRF2 heterodimer.
16918696 Our data suggest that ATRA-induced regulation of Stat2, ICSBP and C/EBPepsilon is dependent on active Stat1, and that a failure to correctly regulate these transcription factors is associated with the inhibition of monocytic differentiation.
16914719 ICSBP tyrosine phosphorylation is necessary for the activation of NF1 transcription. ICSBP is a substrate for SHP2 protein tyrosine phosphatase (SHP2-PTP).
16886895 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16504056 Observational study of gene-disease association. (HuGE Navigator)
16484229 the interaction of IRF-8 with TRAF6 modulates TLR signaling and may contribute to the cross-talk between IFN-gamma and TLR signal pathways
15837792 proteasomal degradation of IRF-8 mediated by the ubiquitin E3 ligase Cbl down-regulates IL-12 expression
15489234 interleukin-12 p35 gene transcription is activated by interferon regulatory factor-1 and interferon consensus sequence-binding protein
15371411 ICSBP1 activates transcription of the gene encoding neurofibromin 1

AA Sequence

MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEG      1 - 70
DKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGR     71 - 140
SEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFY    141 - 210
YGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLL    211 - 280
HSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCF    281 - 350
GEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRE    351 - 420
NQQITV                                                                    421 - 426
//

Text Mined References (104)

PMID Year Title
26613957 2016 IRF5 and IRF8 modulate the CAL-1 human plasmacytoid dendritic cell line response following TLR9 ligation.
26563595 2016 The hematopoietic tumor suppressor interferon regulatory factor 8 (IRF8) is upregulated by the antimetabolite cytarabine in leukemic cells involving the zinc finger protein ZNF224, acting as a cofactor of the Wilms' tumor gene 1 (WT1) protein.
25989711 2015 Association of IRF8 gene polymorphisms with autoimmune thyroid disease.
25903733 2015 GWAS-identified multiple sclerosis risk loci involved in immune response: validation in Russians.
25880423 2015 Identification of NF-?B and PLCL2 as new susceptibility genes and highlights on a potential role of IRF8 through interferon signature modulation in systemic sclerosis.
25749660 2015 Regulation of myelopoiesis by the transcription factor IRF8.
25453760 2014 A negative feedback loop of transcription factors specifies alternative dendritic cell chromatin States.
25387409 2015 Monitoring of WT1 and its target gene IRF8 expression in acute myeloid leukemia and their significance.
25122610 2014 Functional characterization of the human dendritic cell immunodeficiency associated with the IRF8(K108E) mutation.
25109451 2014 Interferon regulatory factor 8 functions as a tumor suppressor in renal cell carcinoma and its promoter methylation is associated with patient poor prognosis.
24957708 2015 Constitutive IRF8 expression inhibits AML by activation of repressed immune response signaling.
24943672 2014 Prediction of response to interferon therapy in multiple sclerosis.
24832596 2014 Interferon consensus sequence-binding protein (ICSBP) promotes epithelial-to-mesenchymal transition (EMT)-like phenomena, cell-motility, and invasion via TGF-? signaling in U2OS cells.
24753251 2014 Regulation of the interferon regulatory factor-8 (IRF-8) tumor suppressor gene by the signal transducer and activator of transcription 5 (STAT5) transcription factor in chronic myeloid leukemia.
24435047 2014 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
24034601 2014 Single-nucleotide polymorphisms of IRF8 gene are associated with systemic lupus erythematosus in Chinese Han population.
23967110 2013 The prognostic significance of IRF8 transcripts in adult patients with acute myeloid leukemia.
23857890 2013 Genome-wide association analysis accounting for environmental factors through propensity-score matching: application to stressful live events in major depressive disorder.
23775715 2013 A capture-sequencing strategy identifies IRF8, EBF1, and APRIL as novel IGH fusion partners in B-cell lymphoma.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23661672 2013 Coronary heart disease in systemic lupus erythematosus is associated with interferon regulatory factor-8 gene variants.
23658517 2013 The EBV Latent Antigen 3C Inhibits Apoptosis through Targeted Regulation of Interferon Regulatory Factors 4 and 8.
23573829 2014 IRF8 is associated with germinal center B-cell-like type of diffuse large B-cell lymphoma and exceptionally involved in translocation t(14;16)(q32.33;q24.1).
23511034 2013 Genome-wide association study of ulcerative colitis in Koreans suggests extensive overlapping of genetic susceptibility with Caucasians.
23468103 2013 Genetic determinants of susceptibility to Mycobacterial infections: IRF8, a new kid on the block.
23314186 2013 Genetic variation associated with circulating monocyte count in the eMERGE Network.
23308054 2012 IRF-8 controls melanoma progression by regulating the cross talk between cancer and immune cells within the tumor microenvironment.
23307532 2013 Mapping of the IRF8 gene identifies a 3'UTR variant associated with risk of chronic lymphocytic leukemia but not other common non-Hodgkin lymphoma subtypes.
23166356 2012 BCL6 positively regulates AID and germinal center gene expression via repression of miR-155.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22994200 2013 Associations of CD6, TNFRSF1A and IRF8 polymorphisms with risk of inflammatory demyelinating diseases.
22942423 2012 The small ubiquitin-like modifier-deconjugating enzyme sentrin-specific peptidase 1 switches IFN regulatory factor 8 from a repressor to an activator during macrophage activation.
22879909 2012 Tagging single nucleotide polymorphisms in the IRF1 and IRF8 genes and tuberculosis susceptibility.
22464253 2012 Identification of IRF8, TMEM39A, and IKZF3-ZPBP2 as susceptibility loci for systemic lupus erythematosus in a large-scale multiracial replication study.
22446963 2012 Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population.
22262849 2012 The leukemia-associated fusion protein Tel-platelet-derived growth factor receptor ? (Tel-PdgfR?) inhibits transcriptional repression of PTPN13 gene by interferon consensus sequence binding protein (Icsbp).
22096565 2011 IRF8 governs expression of genes involved in innate and adaptive immunity in human and mouse germinal center B cells.
22082370 2011 Feedback inhibition of osteoclastogenesis during inflammation by IL-10, M-CSF receptor shedding, and induction of IRF8.
22046141 2011 Association of NCF2, IKZF1, IRF8, IFIH1, and TYK2 with systemic lupus erythematosus.
22003407 2011 Shared and distinct functions of the transcription factors IRF4 and IRF8 in myeloid cell development.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21779181 2011 Identification of novel genetic markers associated with clinical phenotypes of systemic sclerosis through a genome-wide association strategy.
21625229 2011 Interferon consensus sequence binding protein-induced cell proliferation is mediated by TGF-? signaling and p38 MAPK activation.
21552549 2011 The genetic association of variants in CD6, TNFRSF1A and IRF8 to multiple sclerosis: a multicenter case-control study.
21524210 2011 IRF8 mutations and human dendritic-cell immunodeficiency.
21487040 2011 IRF8 regulates acid ceramidase expression to mediate apoptosis and suppresses myelogeneous leukemia.
21475251 2011 ICSBP promoter methylation in myelodysplastic syndromes and acute myeloid leukaemia.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
21228327 2011 IRF8 and IRF3 cooperatively regulate rapid interferon-? induction in human blood monocytes.
21220691 2011 Critical role of IRF-8 in negative regulation of TLR3 expression by Src homology 2 domain-containing protein tyrosine phosphatase-2 activity in human myeloid dendritic cells.
21216962 2011 Positive regulatory domain I (PRDM1) and IRF8/PU.1 counter-regulate MHC class II transactivator (CIITA) expression during dendritic cell maturation.
21178004 2011 IFN regulatory factor 8 restricts the size of the marginal zone and follicular B cell pools.
21131588 2011 Genome-wide association study identifies a novel susceptibility locus at 6p21.3 among familial CLL.
20980339 2011 Hepatitis B viraemia: its heritability and association with common genetic variation in the interferon gamma signalling pathway.
20679491 2010 Interferon consensus sequence binding protein (ICSBP) decreases beta-catenin activity in myeloid cells by repressing GAS2 transcription.
20634887 2010 Polycomb target genes are silenced in multiple myeloma.
20573402 2010 The combination of gene perturbation assay and ChIP-chip reveals functional direct target genes for IRF8 in THP-1 cells.
20435892 2010 Activation of IL-27 p28 gene transcription by interferon regulatory factor 8 in cooperation with interferon regulatory factor 1.
20430450 2010 Validation of the CD6 and TNFRSF1A loci as risk factors for multiple sclerosis in Spain.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19879194 2009 Integration of genetic risk factors into a clinical algorithm for multiple sclerosis susceptibility: a weighted genetic risk score.
19865102 2010 Multiple sclerosis susceptibility alleles in African Americans.
19801548 2009 The interferon consensus sequence binding protein (ICSBP/IRF8) activates transcription of the FANCF gene during myeloid differentiation.
19542426 2009 Modulating the expression of IFN regulatory factor 8 alters the protumorigenic behavior of CD11b+Gr-1+ myeloid cells.
19525953 2009 Meta-analysis of genome scans and replication identify CD6, IRF8 and TNFRSF1A as new multiple sclerosis susceptibility loci.
19074829 2008 DNA methylation represses IFN-gamma-induced and signal transducer and activator of transcription 1-mediated IFN regulatory factor 8 activation in colon carcinoma cells.
18922617 2008 Epigenetic silencing of the interferon regulatory factor ICSBP/IRF8 in human multiple myeloma.
18701018 2008 Mitochondrial gene mutations and type 2 diabetes in Chinese families.
18596738 2009 Decreased IRF8 expression found in aging hematopoietic progenitor/stem cells.
18580679 2008 Expression of the interferon regulatory factor 8/ICSBP-1 in human reactive lymphoid tissues and B-cell lymphomas: a novel germinal center marker.
18469857 2008 Epigenetic disruption of interferon-gamma response through silencing the tumor suppressor interferon regulatory factor 8 in nasopharyngeal, esophageal and multiple other carcinomas.
18316378 2008 Leishmania major infection activates NF-kappaB and interferon regulatory factors 1 and 8 in human dendritic cells.
18246201 2008 Constitutive activation of SHP2 in mice cooperates with ICSBP deficiency to accelerate progression to acute myeloid leukemia.
18195016 2008 The interferon consensus sequence-binding protein (ICSBP/IRF8) represses PTPN13 gene transcription in differentiating myeloid cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17687331 2007 An IRF8-binding promoter variant and AIRE control CHRNA1 promiscuous expression in thymus.
17386941 2007 Phosphorylation of IRF8 in a pre-associated complex with Spi-1/PU.1 and non-phosphorylated Stat1 is critical for LPS induction of the IL1B gene.
17200120 2007 PU.1, interferon regulatory factor (IRF) 2, and the interferon consensus sequence-binding protein (ICSBP/IRF8) cooperate to activate NF1 transcription in differentiating myeloid cells.
17121613 2006 Mapping of nine porcine interferon regulatory factor genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16918696 2006 Inhibition of monocytic differentiation by phosphorylation-deficient Stat1 is associated with impaired expression of Stat2, ICSBP/IRF8 and C/EBPepsilon.
16914719 2006 Leukemia-associated, constitutively active mutants of SHP2 protein tyrosine phosphatase inhibit NF1 transcriptional activation by the interferon consensus sequence binding protein.
16886895 2006 Genetic predisposition of responsiveness to therapy for chronic hepatitis C.
16504056 2006 Polymorphism discovery and association analyses of the interferon genes in type 1 diabetes.
16484229 2006 IRF-8/interferon (IFN) consensus sequence-binding protein is involved in Toll-like receptor (TLR) signaling and contributes to the cross-talk between TLR and IFN-gamma signaling pathways.
15837792 2005 Ubiquitin-dependent degradation of interferon regulatory factor-8 mediated by Cbl down-regulates interleukin-12 expression.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15489234 2004 Synergistic activation of interleukin-12 p35 gene transcription by interferon regulatory factor-1 and interferon consensus sequence-binding protein.
15371411 2004 The interferon consensus sequence-binding protein activates transcription of the gene encoding neurofibromin 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11997525 2002 A novel interferon regulatory factor (IRF), IRF-10, has a unique role in immune defense and is induced by the v-Rel oncoprotein.
10991940 2000 Interaction between interferon consensus sequence-binding protein and COP9/signalosome subunit CSN2 (Trip15). A possible link between interferon regulatory factor signaling and the COP9/signalosome.
10734131 2000 PU.1 and interferon consensus sequence-binding protein regulate the myeloid expression of the human Toll-like receptor 4 gene.
10102295 1999 Interferon-gamma signaling in human retinal pigment epithelial cells mediated by STAT1, ICSBP, and IRF-1 transcription factors.
10092656 1999 Interferon consensus sequence-binding protein is constitutively expressed and differentially regulated in the ocular lens.
9742224 1998 Functional domains of interferon regulatory factor I (IRF-1).
8861914 1996 Immunodeficiency and chronic myelogenous leukemia-like syndrome in mice with a targeted mutation of the ICSBP gene.
7768900 1995 Functional domain analysis of interferon consensus sequence binding protein (ICSBP) and its association with interferon regulatory factors.
1460054 1992 Human interferon consensus sequence binding protein is a negative regulator of enhancer elements common to interferon-inducible genes.