Property Summary

NCBI Gene PubMed Count 114
PubMed Score 263.80
PubTator Score 209.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
systemic lupus erythematosus 1.200 4.2e-04
malignant mesothelioma 1.700 4.2e-06
psoriasis 3.700 7.1e-05
cutaneous lupus erythematosus 3.000 3.0e-04
glioblastoma multiforme 1.300 3.1e-16
juvenile dermatomyositis 3.131 2.6e-17
Amyotrophic Lateral Sclerosis 1.085 1.1e-05
acute quadriplegic myopathy 1.582 7.5e-06
Atopic dermatitis 1.900 2.1e-05
intraductal papillary-mucinous neoplasm ... 2.400 5.2e-04
pancreatic cancer 1.200 9.0e-04
Multiple Sclerosis 1.600 3.6e-02
interstitial cystitis 1.800 1.7e-03
cystic fibrosis 1.300 3.5e-03
subependymal giant cell astrocytoma 1.388 1.5e-02
lung adenocarcinoma 2.000 1.5e-10
non-inflammatory breast cancer 1.500 6.7e-03
breast carcinoma 1.200 1.9e-22
ductal carcinoma in situ 1.300 4.9e-04
invasive ductal carcinoma 1.600 5.6e-04
ovarian cancer 1.800 1.8e-04
pituitary cancer -1.600 1.2e-05
dermatomyositis 1.300 3.1e-02

Gene RIF (95)

PMID Text
26761402 Human IRF7 was shown to be essential for interferon type I-dependent protective immunity against primary influenza. (Review)
26608321 IRF7 cleavage by the 3C protease of enterovirus D68 abrogated its capacity to activate type I interferon expression and limit virus replication.
26597380 Interferon regulatory factor 7 (IRF7) is a direct target of miR-762 and overexpression of miR-762 reduced expression of IRF7.
26005050 Data indicate that the type-I interferon master regulator gene interferon regulatory factor 7 (IRF7) is only hypomethylated in lupus patients with renal involvement.
25911105 The interaction between AIP and IRF7 is enhanced upon virus infection, and AIP potently inhibits IRF7-induced type I IFN (IFN-alpha/beta) production.
25835418 The IRF7 GG genotype associate with Cognitive Decline and Dementia.
25814066 These findings suggest that IRF7-dependent amplification of type I and III IFNs is required for protection against primary infection by influenza virus in humans.
25680411 our results indicate that IRF7 promotes glioma cell invasion and both chemoresistance and radioresistance through AGO2 inhibition
25520509 Authors conclude that paramyxoviruses trigger the DNA damage response, a pathway required for MSK1 activation of phospho Ser 276 RelA formation to trigger the IRF7-RIG-I amplification loop necessary for mucosal interferon production.
25476905 In TSC2-deficient angiomyolipoma patient cells, IRF7 is a pivotal factor in the Rheb/mTOR pathway.
25300801 Authors found that knockdown of IRF7 leads to growth inhibition of Epstein-Barr virus-transformed cells, and restoration of IRF7 by exogenous plasmid correlates with growth recovery of the viral transformed cells.
25225665 phosphorylation-mediated IRF7 transactivation is controlled by a tripod-helix structure.
25170834 HIV-1 Vpr upregulates the expression of interferon regulatory factor 7 in human monocyte-derived macrophages
25159465 Inhibition of the IRF3 and IRF7 innate immune pathways in patients with atopic dermatitis with a history of eczema herpeticum might be an important mechanism for increased susceptibility to disseminated viral infection.
24742347 HIV-1 Vpr upregulates the expression of interferon regulatory factor 7 in human monocyte-derived macrophages
24722640 Our results demonstrate for the first time that IRF3 and IRF7 are both involved in inducing TLR4-dependent IFN-beta expression in response to HSV-2 in its primary infected genital epithelial cells
24531619 Viral infection induced DAPK1-IRF7 and DAPK1-IRF3 interactions and overexpression of DAPK1 enhanced virus-induced activation of the interferon-stimulated response element (ISRE) and IFN-beta promoters and the expression of the IFNB1 gene.
24385435 Interferon regulatory factor (IRF)-3 and -7 are the key transcriptional factors for the induction of IL-28A and IL-28B genes, whereas NF-kappaB is an additional requirement for the induction of the IL-29 gene.
24275658 MAP3K8 mediates the phosphorylation and repression of IRF3 homodimers to promote greater transcriptional activity through utilization of IRF3:IRF7 heterodimers.
23535064 Tat interaction with the 2 MAPKK and IRF7 promoters in HIV-1-infected cells and the resulting persistent activation of interferon-stimulated genes, which include inflammatory cytokines and chemokines, can contribute to the increased immune activation.
23535064 HIV-1 Vpr upregulates the expression of interferon regulatory factor 7 in human monocyte-derived macrophages
23490285 Data indicate that knockdown of IRF-7 expression almost completely diminished the enhancing effect of TLR9 signaling on Foxp3 expression, suggesting that IRF-7 is a downstream molecule of TLR9 signaling.
23175366 In the present study, the authors report that enterovirus 71 downregulates IRF7 through the 3C protein, which inhibits the function of IRF7.
22820642 In over 800 breast cancer patients, high expression of Irf7-regulated genes in primary tumors was associated with prolonged bone metastasis-free survival.
22787218 phosphorylation of IRF7 on Ser477 and Ser479 by IKKepsilon or TBK1 is inhibited by KSHV ORF45
22709905 HIV-1 Vpr upregulates the expression of interferon regulatory factor 7 in human monocyte-derived macrophages
22455868 discuss the association of IRF7 and SLE based on recent understandings to render more information about the mechanisms of IRF7 might perform in
22433914 None of the IRF7 polymorphisms was associated with systemic lupus erythematosus.
22301143 Vesicular stomatitis Indiana virus-activated IRF7 upregulates expression of the BST2 gene independently of interferon signaling.
22194884 IRF5 and IRF7 are key transcription factors in interferon pathway that determine viral sensitivity of lung cancer cells.
22140520 TRAF6 can regulate HIV-1 production and expression of IRF7 promotes HIV-1 replication.
22112518 Reconstruction of the wiring diagram of the modules revealed the presence of hyperconnected hub nodes, most notably interferon regulatory factor 7, which was identified as a major hub linking interferon-mediated antiviral responses.
21940674 The ubiquitin E3 ligase activity of tripartite motif-containing (TRIM)28 protein is specific to IRF7.
21931555 Vaccinia virus protein C6 inhibits the activation of IRF7 by TBK1- and IKKepsilon-dependent pathways.
21926187 IRF7 region is an anticentromere autoantibody propensity locus in systemic sclerosis
21632682 IRF7 single nucleotide polymorphism rs1061501 TT genotype and T allele are enriched in Taiwanese patients with systemic lupus erythematosus (SLE) and seem to be associated with an increased risk of developing SLE.
21435390 Cigarette smoke suppresses key plasmacytoid dendritic cells functions upon viral infection by a mechanism that involves downregulation of TLR7 expression and decreased activation of IRF-7.
21360504 The major allele of a nonsynonymous polymorphism, rs1131665 (412Q) in IRF7, confers elevated activation of IRF-7 and predisposes to the development of systemic lupus erythematosus in multiple ethnic groups.
21167895 Study did not find signi fi cant relationships between rs4963128 or rs2246614 of IRF7/KIAA1542 and the risk of systemic lupus erythematosus, differing from a previous study of European women
21084487 Neurovirulence of interferon-resistant rabies virus correlates with the capacity of the virus phosphoprotein to prevent activation of IRF3 and IRF7.
20980500 IRF-7-induced HPV8 transcription in primary keterinocytes.
20980251 ORF45 may maintain the IRF-7 molecule in the closed form and prevent it from being activated in response to viral infection
20962850 Observational study of gene-disease association. (HuGE Navigator)
20943654 analysis of IFN-stimulated response elements (ISREs) that bind to both the IFN-stimulated gene factor 3 (ISGF3) as well as to IFN response factor 7 (IRF7)
20844090 These findings demonstrate that the lysine residues of IRF-7 play important roles in mediating IFN synthesis and modulating viral lytic replication.
20810735 HCV infection enhances STAT1 expression but impairs nuclear translocation of IRF-7 and its downstream molecules. These impairments in the IFN-alpha signaling pathway may, in part, be responsible for establishment of chronic HCV infection.
20689596 EBV infection correlated with a blockage in the activation of JAK/STAT pathway members and affected the level of phosphorylated IFN regulatory factor 7 (IRF7).
20668674 Results suggest that Ro52-mediated ubiquitination promotes the degradation of IRF7 following TLR7 and TLR9 stimulation.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20483755 IRF3 rather than IRF7 regulates poly (I-C)-induced type I IFN responses in human synoviocytes
20392859 A20 negatively regulates LMP1-stimulated IRF7 ubiquitination and activity in EBV latency.
20381110 The authors show that BRLF1 expression decreased induction of IFN-beta, and reduced expression of IRF3 and IRF7.
20331378 Observational study of gene-disease association. (HuGE Navigator)
20209099 interferon regulatory factor 7C has dual roles in Epstein-Barr virus-mediated lymphocyte transformation
20154210 IRF7 is activated upon Chlamydia pneumoniae infection and is crucial for type I interferon-beta expression
20112359 IRF7/PHRF1 variants in combination with systemic lupus erythematosus-associated autoantibodies result in higher serum levels of IFNalpha
20112359 Observational study of gene-disease association. (HuGE Navigator)
19880818 Smokers after infection with influenza is associated with reduced expression of IRF7 in nasal epithelial cells.
19858727 In contrast, although expression of IRF-7 was higher in Gr II than in the other groups, there was no statistically significant difference (P > 0.05).
19515829 Herpes simplex type 1 infection triggered an IRF-3 and IRF-7-dependent antiviral response.
19426920 mRNA levels of primary Sjogren Syndrome patients were not up-regulated
19404407 IRF-1, IRF-7, type I IFNs, and STAT1 form a signaling feedback loop that is critical in regulating TRAIL expression in HIV-1-infected macrophages.
19349300 transient binding of both IRF-3 and IRF-7, accompanied by CBP/p300 recruitment to the endogenous IFN-A gene promoters, is associated with transcriptional activation
19152337 Altogether, these data further highlight the respective functions of IRF-3 and IRF-7 to program apoptotic, immune and anti-tumor responses.
19017798 efficient IRF7 activation required association with LMP1 CTAR2 in proximity to LMP1 CTAR2 mediated kinase activation sites
18987133 This screening demonstrates that LF2 specifically interacts with the central inhibitory association domain of IRF7, and this interaction leads to inhibition of the dimerization of IRF7, which suppresses IFN-alpha production and IFN-mediated immunity.
18710948 TRAF6 and its E3 ligase activity are required for LMP1-stimulated IRF7 ubiquitination.
18635538 SUMO modification and RIG-I activation are an integral part of IRF3 and IRF7 activity that contributes to postactivation attenuation of IFN production
18539711 Observational study of gene-disease association. (HuGE Navigator)
18505922 epigenetic inactivation of the IFN pathway plays a critical role in cellular immortalization, and the reactivation of IFN-regulated genes by transcription factors IRF5 and/or IRF7 is sufficient to induce cellular senescence
18397234 Our analyses showed a prominent effect of the IRF-7 nonsynonymous SNPs on the risk of developing cirrhosis.
18397234 Observational study of gene-disease association. (HuGE Navigator)
18227218 PI3K selectively controls type I IFN production by regulating IRF-7 nuclear translocation in human pDCs
17522209 Results report a novel immune evasion mechanism of KSHV vIRF3 to block cellular IRF7-mediated innate immunity in response to viral infection.
17404045 In addition to its defined role in type I interferon stimulation, IRF-7 plays a key role in modulating adaptive immune responses by inducing low molecular mass polypeptide-2 (LMP-2) expression, either directly or through induction of IRF-1.
17393359 expression patterns of IRF3 & IRF7 in normal lymph nodes, reactive hyperplastic lymph nodes & pediatric lymphomas; the number of IRF7-positive cells was found to be elevated in the reactive hyperplastic lymph nodes and pediatric lymphoma
17374731 We show that BRCA1, signal transducer and activator of transcription (STAT)-1, and STAT2 are all required for the induction of IRF-7 following stimulation with IFN-gamma.
17079482 Transduction of active forms of IRF-3 or IRF-7 differentially modulate the apoptotic and antitumor properties of primary macrophages.
16778376 IRF7 and LMP1 interact with each other, and this may relate to the mechanism whereby LMP1 exerts functional effects in B-lymphocytes
16237059 LPS-induced B7.1 transcription in human monocytic cells may be regulated by JNK-mediated activation of the IRF-7 transcription factor.
15695821 IRF5 and IRF7 are critical mediators of TLR7 signaling
15664995 there are two distinct mechanisms for the activation of the IRF7 promoter, by IFN and by virus infection
15361868 TLR-mediated IFN-alpha induction requires the formation of a complex consisting of MyD88, TRAF6 and IRF7 as well as TRAF6-dependent ubiquitination.
15308637 IRF-5-and IRF-7-induced innate antiviral response results in a broad alteration of the transcriptional profile of cellular genes
15265881 LPS & HSV upregulate IRF-7 in plasmacytoid dendritic cells. This depends on NF-kappa B activation. Nuclear translocation of IRF-7 occurs rapidly in response to HSV. Activation of IRF-7 contributes to IFN-alpha production in virus-stimulated PDC.
14747533 herpes simplex virus ICP0 blocks interferon regulatory factor IRF7-mediated activation of interferon-stimulated genes; the RING finger domain of ICP0 is essential for this activity
14517278 LPS-TLR4 signaling to IRF-3/7 and NF-kappaB involves the toll adapters TRAM and TRIF.
12915551 Interferon regulatory factor 7 regulates expression of Epstein-Barr virus latent membrane protein 1: a regulatory circuit.
12604599 Interferon regulatory factor-7 synergizes with other transcription factors through multiple interactions with p300/CBP coactivators.
12539042 HIV-1 Vpr upregulates the expression of interferon regulatory factor 7 in human monocyte-derived macrophages
12374802 acetylation of lysine 92 negatively modulates IRF7 DNA binding
11884139 Preferential binding sites for interferon regulatory factors 3 and 7 involved in interferon-A gene transcription
11877397 Stimulation of IRF-7 gene expression by tumor necrosis factor alpha: requirement for NFkappa B transcription factor and gene accessibility
11846980 The structure and function of IRF7 are reviewed

AA Sequence

MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRW      1 - 70
PPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTE     71 - 140
AEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKA    141 - 210
PGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTA    211 - 280
VQEPSPGALDVTIMYKGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELL    281 - 350
RHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRAR    351 - 420
QRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYD    421 - 490
DIECFLMELEQPA                                                             491 - 503
//

Text Mined References (124)

PMID Year Title
26761402 2016 Host genetics of severe influenza: from mouse Mx1 to human IRF7.
26608321 2015 3C Protease of Enterovirus D68 Inhibits Cellular Defense Mediated by Interferon Regulatory Factor 7.
26597380 2015 microRNA-762 promotes breast cancer cell proliferation and invasion by targeting IRF7 expression.
26005050 2015 Renal involvement in lupus is characterized by unique DNA methylation changes in naïve CD4+ T cells.
25911105 2015 Aryl Hydrocarbon Receptor Interacting Protein Targets IRF7 to Suppress Antiviral Signaling and the Induction of Type I Interferon.
25835418 2015 Variants in Antiviral Genes are Risk Factors for Cognitive Decline and Dementia.
25814066 2015 Infectious disease. Life-threatening influenza and impaired interferon amplification in human IRF7 deficiency.
25680411 2015 IRF7 promotes glioma cell invasion by inhibiting AGO2 expression.
25520509 2015 Ataxia telangiectasia mutated kinase mediates NF-?B serine 276 phosphorylation and interferon expression via the IRF7-RIG-I amplification loop in paramyxovirus infection.
25476905 2014 Analysis of gene expression array in TSC2-deficient AML cells reveals IRF7 as a pivotal factor in the Rheb/mTOR pathway.
25300801 2015 Interferon regulatory factor 7 is involved in the growth of Epstein-Barr virus-transformed human B lymphocytes.
25225665 2014 Serine cluster phosphorylation liberates the C-terminal helix of IFN regulatory factor 7 to bind histone acetyltransferase p300.
25159465 2014 Identification of novel gene signatures in patients with atopic dermatitis complicated by eczema herpeticum.
24722640 2014 HSV-2 increases TLR4-dependent phosphorylated IRFs and IFN-? induction in cervical epithelial cells.
24531619 2014 Death-associated protein kinase 1 is an IRF3/7-interacting protein that is involved in the cellular antiviral immune response.
24385435 2014 Transcriptional regulation of IFN-? genes in hepatitis C virus-infected hepatocytes via IRF-3·IRF-7·NF-?B complex.
24275658 2014 Mitogen-activated protein kinase-mediated licensing of interferon regulatory factor 3/7 reinforces the cell response to virus.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23535064 2013 Tat engagement of p38 MAP kinase and IRF7 pathways leads to activation of interferon-stimulated genes in antigen-presenting cells.
23490285 2013 DNA methylation impairs TLR9 induced Foxp3 expression by attenuating IRF-7 binding activity in fulminant type 1 diabetes.
23175366 2013 Cleavage of interferon regulatory factor 7 by enterovirus 71 3C suppresses cellular responses.
22820642 2012 Silencing of Irf7 pathways in breast cancer cells promotes bone metastasis through immune escape.
22787218 2012 ORF45 of Kaposi's sarcoma-associated herpesvirus inhibits phosphorylation of interferon regulatory factor 7 by IKK? and TBK1 as an alternative substrate.
22455868 2012 IRF7, a functional factor associates with systemic lupus erythematosus.
22433914 2012 Association of PHRF1-IRF7 region polymorphism with clinical manifestations of systemic lupus erythematosus in a Japanese population.
22301143 2012 Virus-activated interferon regulatory factor 7 upregulates expression of the interferon-regulated BST2 gene independently of interferon signaling.
22194884 2011 Epigenetic silencing of IRF7 and/or IRF5 in lung cancer cells leads to increased sensitivity to oncolytic viruses.
22140520 2011 TRAF6 and IRF7 control HIV replication in macrophages.
22112518 2012 Interferon regulatory factor 7 is a major hub connecting interferon-mediated responses in virus-induced asthma exacerbations in vivo.
22065573 2011 Nuclear factor ?B subunits RelB and cRel negatively regulate Toll-like receptor 3-mediated ?-interferon production via induction of transcriptional repressor protein YY1.
21940674 2011 Tripartite motif-containing protein 28 is a small ubiquitin-related modifier E3 ligase and negative regulator of IFN regulatory factor 7.
21931555 2011 Vaccinia virus protein C6 is a virulence factor that binds TBK-1 adaptor proteins and inhibits activation of IRF3 and IRF7.
21926187 2012 Novel identification of the IRF7 region as an anticentromere autoantibody propensity locus in systemic sclerosis.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21632682 2011 The potential role of interferon-regulatory factor 7 among Taiwanese patients with systemic lupus erythematosus.
21490621 2011 IRF7: activation, regulation, modification and function.
21435390 2011 Cigarette smoke suppresses TLR-7 stimulation in response to virus infection in plasmacytoid dendritic cells.
21360504 2011 Association of a functional IRF7 variant with systemic lupus erythematosus.
21167895 2011 Association of genetic variations in the STAT4 and IRF7/KIAA1542 regions with systemic lupus erythematosus in a Northern Han Chinese population.
21084487 2011 Genetic dissection of interferon-antagonistic functions of rabies virus phosphoprotein: inhibition of interferon regulatory factor 3 activation is important for pathogenicity.
20980500 2011 Differential regulation of human papillomavirus type 8 by interferon regulatory factors 3 and 7.
20980251 2011 Mechanisms of autoinhibition of IRF-7 and a probable model for inactivation of IRF-7 by Kaposi's sarcoma-associated herpesvirus protein ORF45.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20943654 2010 Transcription factor redundancy ensures induction of the antiviral state.
20844090 2011 Lysine residues of interferon regulatory factor 7 affect the replication and transcription activator-mediated lytic replication of Kaposi's sarcoma-associated herpesvirus/human herpesvirus 8.
20810735 2010 Hepatitis C virus infection impairs IRF-7 translocation and Alpha interferon synthesis in immortalized human hepatocytes.
20689596 2010 Epstein-Barr virus interferes with the amplification of IFNalpha secretion by activating suppressor of cytokine signaling 3 in primary human monocytes.
20668674 2010 Self protection from anti-viral responses--Ro52 promotes degradation of the transcription factor IRF7 downstream of the viral Toll-Like receptors.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20483755 2010 Synoviocyte innate immune responses: II. Pivotal role of IFN regulatory factor 3.
20392859 2010 The A20 deubiquitinase activity negatively regulates LMP1 activation of IRF7.
20381110 2010 Epstein-Barr virus BRLF1 inhibits transcription of IRF3 and IRF7 and suppresses induction of interferon-beta.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20209099 2010 Dual functions of interferon regulatory factors 7C in Epstein-Barr virus-mediated transformation of human B lymphocytes.
20154210 2010 Essential role of mitochondrial antiviral signaling, IFN regulatory factor (IRF)3, and IRF7 in Chlamydophila pneumoniae-mediated IFN-beta response and control of bacterial replication in human endothelial cells.
20112359 2010 Genetic variation at the IRF7/PHRF1 locus is associated with autoantibody profile and serum interferon-alpha activity in lupus patients.
20049431 2010 Regulation of immunity and oncogenesis by the IRF transcription factor family.
19880818 2010 Reduced expression of IRF7 in nasal epithelial cells from smokers after infection with influenza.
19858727 2010 Disease progression from chronic hepatitis C to cirrhosis and hepatocellular carcinoma is associated with repression of interferon regulatory factor-1.
19515829 2009 Infection with herpes simplex type 1-based amplicon vectors results in an IRF3/7-dependent, TLR-independent activation of the innate antiviral response in primary human fibroblasts.
19426920 2009 Expression of interferon regulatory factor 1, 3, and 7 in primary Sjögren syndrome.
19404407 2009 Type I interferons and interferon regulatory factors regulate TNF-related apoptosis-inducing ligand (TRAIL) in HIV-1-infected macrophages.
19349300 2009 Differential regulation of human interferon A gene expression by interferon regulatory factors 3 and 7.
19176627 2009 The infected cell protein 0 encoded by bovine herpesvirus 1 (bICP0) associates with interferon regulatory factor 7 and consequently inhibits beta interferon promoter activity.
19152337 2009 Transcriptional re-programming of primary macrophages reveals distinct apoptotic and anti-tumoral functions of IRF-3 and IRF-7.
19017798 2008 IRF7 activation by Epstein-Barr virus latent membrane protein 1 requires localization at activation sites and TRAF6, but not TRAF2 or TRAF3.
18987133 2009 Epstein-Barr virus LF2: an antagonist to type I interferon.
18922877 2008 Measles virus V protein is a decoy substrate for IkappaB kinase alpha and prevents Toll-like receptor 7/9-mediated interferon induction.
18710948 2008 TRAF6 and the three C-terminal lysine sites on IRF7 are required for its ubiquitination-mediated activation by the tumor necrosis factor receptor family member latent membrane protein 1.
18635538 2008 Virus infection triggers SUMOylation of IRF3 and IRF7, leading to the negative regulation of type I interferon gene expression.
18539711 2008 Promoter polymorphisms in the IRF3 gene confer protection against systemic lupus erythematosus.
18505922 2008 Interferon regulatory factors IRF5 and IRF7 inhibit growth and induce senescence in immortal Li-Fraumeni fibroblasts.
18397234 2008 Association of interferon regulatory factor-7 gene polymorphism with liver cirrhosis in chronic hepatitis C patients.
18227218 2008 PI3K is critical for the nuclear translocation of IRF-7 and type I IFN production by human plasmacytoid predendritic cells in response to TLR activation.
17599067 2007 Involvement of the ubiquitin-like domain of TBK1/IKK-i kinases in regulation of IFN-inducible genes.
17522209 2007 Inhibition of interferon regulatory factor 7 (IRF7)-mediated interferon signal transduction by the Kaposi's sarcoma-associated herpesvirus viral IRF homolog vIRF3.
17404045 2007 IRF-7: new role in the regulation of genes involved in adaptive immunity.
17393359 Differential expression patterns of IRF3 and IRF7 in pediatric lymphoid disorders.
17374731 2007 BRCA1 regulates IFN-gamma signaling through a mechanism involving the type I IFNs.
17301153 2007 Rotavirus NSP1 inhibits expression of type I interferon by antagonizing the function of interferon regulatory factors IRF3, IRF5, and IRF7.
17121613 2006 Mapping of nine porcine interferon regulatory factor genes.
17079482 2006 Distinct roles for IFN regulatory factor (IRF)-3 and IRF-7 in the activation of antitumor properties of human macrophages.
16979567 2006 Type I interferon [corrected] gene induction by the interferon regulatory factor family of transcription factors.
16846591 2006 Distinct functions of IRF-3 and IRF-7 in IFN-alpha gene regulation and control of anti-tumor activity in primary macrophages.
16778376 2006 Colocalization of interferon regulatory factor 7 (IRF7) with latent membrane protein 1 (LMP1) of Epstein-Barr virus.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16237059 2005 Regulation of B7.1 costimulatory molecule is mediated by the IFN regulatory factor-7 through the activation of JNK in lipopolysaccharide-stimulated human monocytic cells.
16127453 2005 IPS-1, an adaptor triggering RIG-I- and Mda5-mediated type I interferon induction.
15767370 2005 Interleukin-1 receptor-associated kinase-1 plays an essential role for Toll-like receptor (TLR)7- and TLR9-mediated interferon-{alpha} induction.
15695821 2005 The interferon regulatory factor, IRF5, is a central mediator of toll-like receptor 7 signaling.
15664995 2005 Regulation of the transcriptional activity of the IRF7 promoter by a pathway independent of interferon signaling.
15492225 2004 Role of a transductional-transcriptional processor complex involving MyD88 and IRF-7 in Toll-like receptor signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15367631 2004 Activation of TBK1 and IKKvarepsilon kinases by vesicular stomatitis virus infection and the role of viral ribonucleoprotein in the development of interferon antiviral immunity.
15361868 2004 Interferon-alpha induction through Toll-like receptors involves a direct interaction of IRF7 with MyD88 and TRAF6.
15308637 2004 Global and distinct targets of IRF-5 and IRF-7 during innate response to viral infection.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15265881 2004 Regulation of IFN regulatory factor-7 and IFN-alpha production by enveloped virus and lipopolysaccharide in human plasmacytoid dendritic cells.
14759258 2004 An unappreciated role for RNA surveillance.
14747533 2004 The herpes simplex virus ICP0 RING finger domain inhibits IRF3- and IRF7-mediated activation of interferon-stimulated genes.
14739303 2004 Mechanisms of the TRIF-induced interferon-stimulated response element and NF-kappaB activation and apoptosis pathways.
14517278 2003 LPS-TLR4 signaling to IRF-3/7 and NF-kappaB involves the toll adapters TRAM and TRIF.
12915551 2003 Interferon regulatory factor 7 regulates expression of Epstein-Barr virus latent membrane protein 1: a regulatory circuit.
12692549 2003 IKKepsilon and TBK1 are essential components of the IRF3 signaling pathway.
12604599 2003 Interferon regulatory factor-7 synergizes with other transcription factors through multiple interactions with p300/CBP coactivators.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12374802 2002 Acetylation of interferon regulatory factor-7 by p300/CREB-binding protein (CBP)-associated factor (PCAF) impairs its DNA binding.
11943871 2002 A Kaposi's sarcoma-associated herpesviral protein inhibits virus-mediated induction of type I interferon by blocking IRF-7 phosphorylation and nuclear accumulation.
11884139 2002 Preferential binding sites for interferon regulatory factors 3 and 7 involved in interferon-A gene transcription.
11877397 2002 Stimulation of IRF-7 gene expression by tumor necrosis factor alpha: requirement for NFkappa B transcription factor and gene accessibility.
11846980 2002 Structure and function of IRF-7.
11314014 2001 HHV-8 encoded vIRF-1 represses the interferon antiviral response by blocking IRF-3 recruitment of the CBP/p300 coactivators.
11162841 2001 Analysis of functional domains of interferon regulatory factor 7 and its association with IRF-3.
11124948 2001 IRF3 and IRF7 phosphorylation in virus-infected cells does not require double-stranded RNA-dependent protein kinase R or Ikappa B kinase but is blocked by Vaccinia virus E3L protein.
11073981 2000 Phosphorylation-induced dimerization of interferon regulatory factor 7 unmasks DNA binding and a bipartite transactivation domain.
11031102 2000 Characterization of a 500-kb contig spanning the region between c-Ha-Ras and MUC2 on chromosome 11p15.5.
10924517 2000 Regulation of the promoter activity of interferon regulatory factor-7 gene. Activation by interferon snd silencing by hypermethylation.
9865487 Role of the interferon regulatory factors (IRFs) in virus-mediated signaling and regulation of cell growth.
9786932 1998 Characterization of the interferon regulatory factor-7 and its potential role in the transcription activation of interferon A genes.
9660935 1998 Virus infection induces the assembly of coordinately activated transcription factors on the IFN-beta enhancer in vivo.
9315633 1997 IRF-7, a new interferon regulatory factor associated with Epstein-Barr virus latency.