Property Summary

NCBI Gene PubMed Count 197
PubMed Score 219.77
PubTator Score 246.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.060 1.9e-04

Gene RIF (216)

PMID Text
27092776 IRF5 and PADI4 significantly discriminated between RA patients and healthy controls in LDA.
26613957 IRF5 and IRF8, two transcription factors with opposing functions, control TLR9 signaling in human plasmacytoid dendritic cells.
26519527 the data demonstrate a critical mechanism by which sex differences in basal plasmacytoid dendritic cell IRF5 expression lead to higher IFN-alpha production upon TLR7 stimulation in females.
26294277 Genetic associations and gene-gene interactions of IRF5 and TYK2 were significantly detected in Han Chinese with systemic lupus erythematosus
26233721 meta-analysis demonstrated the IRF5 rs2070197 polymorphism conferred susceptibility to systemic lupus erythematosus (SLE) in all subjects without inter-study heterogeneity; IRF5 rs2070197 polymorphism was identified as risk factors for SLE in Caucasian populations but it had no effects in Asians
26112714 four single nucleotide polymorphisms studied in IRF5 may affect neither Neuromyelitis optica nor Multiple sclerosis in the Southeastern Han Chinese population
26004104 Study indicates that high-level IRF-5 expression is specific to HTLV-1-infected T cells and regulated by Tax viral protein.
25649192 A conserved region within interferon regulatory factor 5 controls breast cancer cell migration through a cytoplasmic and transcription-independent mechanism.
25572744 Polymorphisms of IRF5 may play an important role in susceptibility to systemic sclerosis.
25564941 The polymorphisms in the IRF5 gene may play a role in the development of Crohn's Disease in the Malaysian population, as seen in the significant associations of SNPs, that is, rs3807306, rs10954213 and rs11770589.
25557482 IRF-5 is suppressed by hypermethylation of its promoter-A in most of EBV-infected transformed cells, especially Burkitt's lymphomas and EBV-associated gastric carcinoma (EBVaGC)
25533286 regulates CXCL13-mediated recruitment of B and T cells to IRF5-positive tumor-conditioned media
25392335 h Epstein-Barr virus and Mycobacterium avium subsp. paratuberculosis epitopes of IRF5 elicit a consistent humoral response in multiple sclerosis patients
25337792 TNFAIP3 and IRF5 polymorphisms were associated with polymyositis/dermatomyositis in Chinese Han patients with interstitial lung disease.
25326420 IKKbeta is an IRF5 kinase that instigates inflammation
25326418 IKKbeta activates two "master" transcription factors of the innate immune system, IRF5 and NF-kappaB
25288773 IRF5 is a key regulator in classical Hodgkin lymphoma, according to transcription factor motifs
25284481 IRF5rs2004640 T (mutant) allele may be a susceptibility factor conferring risk for RA in South Indian Tamils, whereas G allele (wild type) may be protective.
25263394 study gives no definite evidence for a pathogenic genetic link of periodontitis and RA but suggests IRF5 and PRDM1 as shared susceptibility factors.
25205108 IRF5-TNPO3 genetic variation is associated systemic lupus erythematosus.
25084355 TRIpartite motif 21 (TRIM21) differentially regulates the stability of interferon regulatory factor 5 (IRF5) isoforms.
25036352 Meta-analysis certified that IRF5 polymorphisms confer susceptibility to systemic lupus erythematous, multiple sclerosis, and systemic sclerosis.
25011482 Our results reveal that IRF5 gene variants are associated with risk of cardiovascular events in patients with Rheumatoid arthritis
24943672 gene variants in IRF5, IRF8 and GPC5 were not associated with risk of relapse or disease progression in multiple sclerosis
24928322 Studies indicate that polymorphisms of the interferon regulatory factor 5 (IRF5) gene in can result in risk or protective haplotypes with regard to Systemic Lupus Erythematosus (SLE). susceptibility
24788560 results indicate that T3-bound TRs interfere with transactivation by TEADs via protein-protein interactions, resulting in the negative regulation of MYH7 promoter activity
24697591 The association of IRF5 markers (rs2004640, rs10954213) with susceptibility to SLE and to the development of more than one autoimmune disease (OP) and to analyse the influence of rs2004640 on IRF5 isoform expression were explored
24697319 Unlike other studies, this study found no association of the rs2004640 SNP with SLE among Han Chinese. It did however interact with SNPS in ETS1, STAT4, and IKZF1.
24582590 No significant association was found between all IRF5 SNPs (rs10954213, rs2004640, rs3807306, rs752637 and rs7808907) and ophthalmopathy in Graves' patients.
24532789 Vpx expression results in decreased promoter binding activity of IRF5
24445143 Our data identify IRF5 as a downstream target of the BCR-ABL kinase, suggesting that its biological inactivation contributes to leukemic transformation.
24350899 The IRF5's promoter polymorphisms alter first exon usage and increase transcription levels and high levels of IRF5 may bias the immune system toward autoimmunity.
24116155 Results show that two functional genetic variants of regulatory factor 5 (IRF5) may play a role in the development of macular edema in non-anterior uveitis patients.
24014567 A redundant interaction between IRF5 and STAT4 polymorphisms was found in susceptibility to the type I interferon pathway-associated rheumatic autoimmune diseases, systemic lupus erythematosus and rheumatoid arthritis.
23990993 Data show that cyclosporin A (CsA) inhibited rotavirus replication and restored interferon-beta (IFN-beta) expression, and promoted Interferon Regulatory Factor-5 (IRF-5) expression in a HT-29 cell line model.
23985571 IRF5 rs10954213G is significantly increased in MPO-ANCA-positive vasculitis patients.
23971939 Single nucleotide polymorphisms in IRF5, but not TLR4, DEFEB1, or VDR, are associated with the risk of ulcerative colitis in a Han Chinese population.
23941291 We have found that three polymorphisms in linkage disequilibrium with the protective haplotypes of IRF5 have differential allele effects
23883595 The IRF5 could significantly affect these immune cells participating in the pathogenesis of SLE, and numerous studies implied that this transcription factor is mechanistically linked to the disease progression.
23801380 meta-analysis. The results suggest that the IRF5 rs2004640 polymorphism is associated with rheumatoid arthritis especially when the dominant genetic model is applied.
23616277 Results show that interferon regulatory factor-5 (IRF-5) and NF-kappaB p50 are key co-regulators of IFN-beta and IL-6 expression following TLR9-mediated activation of human plasmacytoid dendritic cells
23392701 This meta-analysis suggests that the A allele of rs10954213 and TCA haplotype (rs2004640-rs2070197-rs10954213) in IRF5 is associated with the increased risk of SLE in different ethnic groups, and its prevalence is ethnicity dependent.
23372721 The systemic lupus erythematosus IRF5 risk haplotype is associated with systemic sclerosis.
23349905 Results from this study provide the first proof that SLE patients express an IRF5 transcript signature that is distinct from healthy donors; an IRF5-SLE risk haplotype defines the top four most abundant IRF5 transcripts expressed in SLE patients.
23302156 DNA methylation patterns of the promoter region of IRF5 to were investigated determine whether its epigenetic deregulation could explain the increased expression of IRF5 mRNA in primary Sjogren's syndrome patients.
23288367 A haplotype carrying two functional SNPs of IRF5, rs10954213A and rs2280714A, was associated with the risk of sarcoidosis in the Japanese population.
23275442 CSN subunit 3 (CSN3) was identified as a direct interacting partner of IRF5.
23236436 gene-gene epistatic interactions revealed between IRF5 and IKZF1 in systemic lupus erythematosus.
23154183 The dual commitment of IRF3 and IRF5 in the regulation of the Il12b enhancer and promoter is unique and may have implications for understanding the evolution of this gene.
23073787 The IRF5 rs2004640, rs729302 and rs752637 polymorphisms are associated with rheumatoid arthritis susceptibility. [Meta-analysis]
22909381 study is the first to analyze associations between melanoma immune responsiveness and IRF5 polymorphism. The results support a common genetic basis which may underline the development of autoimmunity and melanoma immune responsiveness
22816737 A 4-fold downregulation of IRF5 was seen in splenic marginal-zone lymphomas with 7q32 deletion vs non-deleted tumours. Ectopic expression of IRF5 decreased proliferation & increased apoptosis in vitro, & impaired lymphoma development in vivo.
22730365 By participating in transcription complex with other co-factors, IRF5 and STAT4 harbour the potential of regulating a large number of target genes, which may contribute to their strong association with systemic lupus erythematosus
22674082 These data suggest that IRF5 polymorphisms play a role in serologic autoimmunity in humans and may promote the progression to clinical autoimmunity.
22544929 IRF5 disease-associated polymorphisms to a wide spectrum of microbial triggers has broad implications for global immunological responses, host defenses against pathogens, and inflammatory/autoimmune disease susceptibility.
22507190 in thyroid malignancies, IRF5 displays tumor-promoting rather than tumor-suppressor activities.
22500098 One known genetic factor associated with lupus is a haplotype of the IRF5 gene. Gene expression microarray data identified multiple interferon- and inflammation-related gene sets significantly overrepresented in cells with the risk haplotype.
22440820 IRF5 polymorphism predicts prognosis in patients with systemic sclerosis.
22257839 IRF5 polymorphisms contribute to the risk profile for Crohn's disease and ulcerative colitis.
22194884 IRF5 and IRF7 are key transcription factors in interferon pathway that determine viral sensitivity of lung cancer cells.
22179739 Interferon regulatory factor 5 gene polymorphism confers risk to several rheumatic diseases and correlates with expression of alternative thymic transcripts.
22088620 The data supports the concept that IRF5 functional genetic elements contribute to SLE risk through their relationship with auto-antibodies and IFNalpha production.
22053985 IRF5 is an important tumor suppressor that regulates multiple cellular processes involved in the conversion of normal mammary epithelial cells to tumor epithelial cells with metastatic potential.
22025054 Studies indicate that the M1 macrophage phenotype is controlled by STAT1 and IRF5, whereas STAT6, IRF4 and PPARgamma regulate M2 macrophage polarization.
21968701 This study provides the first formal proof that IRF-5 activation is altered in the monocytes of systemic lupus erythematosus patients.
21898142 genetic polymorphism is associated with susceptibility to hemophagocytic lymphohistiocytosis in children
21834935 suggested that IRF5 gene polymorphism was associated with systemic lupus erythematosus in multiple ethnic populations
21807777 Two interferon regulatory factor 5 (IRF5) gene variants were examined for association with rheumatoid arthritis and were relevant for RA susceptibility, especially for seronegative RA.
21627826 Although the systemic lupus erythematosus risk haplotype of IRF5 is associated with high expression of the gene, cis-regulation of IRF5 expression is not enough to fully account for IRF5 association with susceptibility.
21471993 These findings suggest a role for IRF5 gene variation in the pharmacological and clinical outcome of IFNbeta therapy that might have relevance as biomarker to predict the response to IFNbeta in multiple sclerosis.
21454650 Interferon regulatory factor 4 (IRF-4) targets IRF-5 to regulate Epstein-Barr virus transformation
21239750 Data suggest that IRF5 gene polymorphism is a genetic factor influencing susceptibility to macrophage activation syndrome (MAS) in patients with systemic juvenile idiopathic arthritis, and IRF5 contributes to the pathogenesis of MAS in these patients.
21133648 The cellular IRF5 and vIRF3 interact, leading to the functional modulation of IRF5-mediated type I IFN expression and cell cycle regulation.
21040166 Suggest that the rs2004640 T allele was associated with susceptibility to lupus nephritis and that the IRF5 polymorphism analyzed did not seem to be implicated in the pathology and clinical manifestation of lupus nephritis in the Chinese population.
21040166 Observational study of gene-disease association. (HuGE Navigator)
20980283 This study provides the 'association and linkage proof' establishing IRF5 as a rheumatoid arthritis susceptibility gene and the identification of a genetic factor that seems to contribute to the modulation of the erosive phenotype.
20980283 Observational study of gene-disease association. (HuGE Navigator)
20962850 Observational study of gene-disease association. (HuGE Navigator)
20935208 These data provide the first evidence whereby IRF5 regulates proinflammatory cytokine expression in conjunction with HATs and HDACs.
20881011 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20861862 IRF5 gene confers only a modest increase in the susceptibility to multiple sclerosis, but this association is relevant as it involves a pathway that may be correlated with a therapeutic intervention.
20861862 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20861858 Observational study of gene-disease association. (HuGE Navigator)
20848568 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20797713 Observational study of gene-disease association. (HuGE Navigator)
20695768 IRF5 exon 6 structural variants that occur as part of a systemic lupus erythematosus (SLE) risk haplotypes modulate IRF5 function.
20639880 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20639879 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20616560 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20479942 Observational study of gene-disease association. (HuGE Navigator)
20453842 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20453440 studies found that IRF5, STAT4 and BLK are associated not only with systemic lupus erythematosus, but also rheumatoid arthritis and systemic sclerosis [review]
20439292 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20383147 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20351107 c-Src modulation and ATF3 activity may contribute to differential regulation of IRF-3- versus IRF-5-mediated gene expression
20237317 Systematic bioinformatic and biochemical analyses of the TNF gene locus map 2 sites of IRF5 recruitment: 5' upstream and 3' downstream of the TNF gene.
20231204 Our study provides further evidence of a key role of IRF5 in severity of systemic sclerosis.
20231204 Observational study of gene-disease association. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
20197570 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20137629 The polymorphism of rs2004640 and rs10954213 in IRF5 may be associated with SLE in Han Chinese.
20131273 Differences in the genetic effects of IRF5 between antiphospholipid syndrome and systemic lupus erythematosus may contribute to some of the clinical differences between these entities.
20131273 Observational study of gene-disease association. (HuGE Navigator)
20127100 These results implicate that epigenetic dysregulation of the IRF5 promoter is unlikely to be associated with inflammatory bowel diseases.
20112383 IRF-5 expression and alternative splicing are significantly up-regulated in primary blood cells of patients with systemic lupus erythematosus
20112383 Observational study of gene-disease association. (HuGE Navigator)
20090783 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20080916 There is an association of promoter indel in IRF5 with systemic lupus erythematosus in 5 different populations, and rs10954213 is the main single-nucleotide polymorphism responsible for altered IRF5 expression in peripheral blood mononuclear cells.
20080916 Observational study of gene-disease association. (HuGE Navigator)
20049410 a IRF5 haplotype is associated with reduced risk to Wegener's granulomatosis
20049410 Observational study of gene-disease association. (HuGE Navigator)
20015215 Observational study of gene-disease association. (HuGE Navigator)
19918036 Results showed no association of IRF5 rs2004640 and CGGGG insertion/deletion polymorphisms in the susceptibility to and clinical expression of giant cell arteritis.
19918036 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19877059 BANK1 is a new systemic sclerosis genetic susceptibility factor. BANK1, IRF5, and STAT4 act with additive effects.
19877059 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19854706 Single nucleotide polymorphisms of IRF5 in healthy individuals of a number of ethnic groups were associated with increased mRNA expression of IRF5.
19854706 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19838193 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19816589 The rs2280714 and rs752637 single nucleotide polymorphisms of IRF5 were not associated with the susceptibility to Behcet's disease.
19816589 Observational study of gene-disease association. (HuGE Navigator)
19786094 show that IKK alpha phosphorylates IRF-5 and induces formation of IRF-5 dimers, which have been indicative of IRF-5 activation.
19778284 The 5 bp indel (CGGGG) polymorphism of the IRF-5 gene may be associated with susceptibility to acute coronary syndrome.
19778284 Observational study of gene-disease association. (HuGE Navigator)
19758313 rs10954213 associated with increased risk of discoid lupus erythematosus
19644887 STAT4 and IRF5 act with additive effects in terms of susceptibility to both systemic sclerosis(SSc) and SSc-related fibrosing alveolitis.
19644887 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19644876 STAT4 and BLK displayed a strong genetic association with primary antiphospholipid syndrome, while a weak association with IRF5 and no association with BANK1 were observed.
19644876 Observational study of gene-disease association. (HuGE Navigator)
19567624 The IFN pathway genes IRF5 and TYK2 may act epistatically in increasing risk for systemic lupus erythematosus
19565491 There is an association of the CGGGG insertion/deletion polymorphism of the IRF5 promoter with primary Sjogren's syndrome.
19565491 Observational study of gene-disease association. (HuGE Navigator)
19479858 Association of IRF5 with systemic sclerosis was replicated in a Japanese population.
19479858 Observational study of gene-disease association. (HuGE Navigator)
19430534 The functional characterization of the novel IRF-5 mutant in transformed B and T cell lines and in ATL and CLL patients may lead to a better understanding of the role of these transcriptional regulators in hematopoietic malignancies.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19228650 Results supported the evidence of the significant role of IRF5 polymorphisms in rheumatoid arthritis.
19228650 Meta-analysis of gene-disease association. (HuGE Navigator)
19129183 vIRF-3 antagonized IRF-5-mediated activation of the p21 promoter.
19116937 The IRF5 rs2004640 GT substitution is associated with susceptibility to systemic sclerosis providing clues to the mechanisms leading to fibrosing alveolitis
19116937 Observational study of gene-disease association. (HuGE Navigator)
19092842 Additive effects of the major risk alleles of IRF5 and STAT4 in primary Sjogren's syndrome are reported.
19092842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19043711 A meta-analysis was performed between the functional polymorphism of IRF5 and systemic lupus erythematosus.
19028697 results presented here identify IRF-5 as a new mediator of DR signaling and provides molecular insight into the mechanism of TRAIL-induced IRF-5 signaling
19019891 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18843785 IRF5 polymorphism is associated with genetic susceptibility to rheumatoid arthritis at least in a Korean population
18843785 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18843782 genetic effects of IRF5 polymorphisms on the risk of systemic lupus erythematosus according to ethnicity
18843782 Observational study of gene-disease association. (HuGE Navigator)
18824541 Data show that IRF-5, which is activated via the MyD88 pathway, is subjected to TRAF6-mediated K63-linked ubiquitination, which is important for IRF-5 nuclear translocation and target gene regulation.
18752149 TT genotype of the rs2004640 dimorphism associated with rheumatoid arthritis in a Tunisian population
18752149 Observational study of gene-disease association. (HuGE Navigator)
18668568 The IRF5 systemic lupus erythematosus (SLE) risk haplotype is associated with higher serum IFNalpha activity in SLE patients.
18668568 Observational study of gene-disease association. (HuGE Navigator)
18579578 The SNP rs7582694 in STAT4 displayed a increased risk of systemic lupus erythematosus with two independent risk alleles of the IRF5.
18505922 epigenetic inactivation of the IFN pathway plays a critical role in cellular immortalization, and the reactivation of IFN-regulated genes by transcription factors IRF5 and/or IRF7 is sufficient to induce cellular senescence
18438842 IRF5 polymorphisms seem to influence RA susceptibility
18438842 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18408250 findings indicate that the promoter polymorphism of IRF5 is a genetic factor conferring predisposition to RA, and that it contributes considerably to disease pathogenesis in patients that were SE negative.
18408250 Observational study of gene-disease association. (HuGE Navigator)
18332133 reveal the cell type-specific importance of IRF-5 in MyD88-mediated antiviral pathways and the widespread role of IRF-5 in the regulation of inflammatory cytokines
18323517 IRF5 mRNA is expressed in cells in atherosclerotic tissue and its expression is modified by single nucleotide polymorphisms in the IRF5 gene.
18323517 Observational study of gene-disease association. (HuGE Navigator)
18311811 IRF5 was found to be associated with systemic lupus erythematosus in Asian populations. Intron 1 single-nucleotide polymorphisms, rather than exon 6 and 3'-untranslated region polymorphisms, appeared to play a crucial role.
18311811 Observational study of gene-disease association. (HuGE Navigator)
18288123 Genetic variants of IRF5 associate with systemic lupus erythematosus (SLE) in multiple populations, providing evidence that IRF5 is likely to be a crucial component in SLE pathogenesis among multiple ethnic groups.
18288123 Observational study of gene-disease association. (HuGE Navigator)
18285424 These findings add IRF5 to the short list of genes shown to be associated with multiple sclerosis in more than one population.
18285424 Observational study of gene-disease association. (HuGE Navigator)
18260169 a haplotype of IRF5 (interferon regulatory factor 5) gene has ssociation with systemic lupus erythematosus in Chinese
18260169 Observational study of gene-disease association. (HuGE Navigator)
18200047 Polymorphisms at IRF5 did not associate with psoriasis per se; however, an interaction with class I major histocompatibility complex (MHC) genes was found.
18200047 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18063667 IRF5 allele confers risk for inflammatory bowel diseases and multiple sclerosis, suggesting a general role for IRF5 in autoimmune diseases
18063667 Observational study of gene-disease association. (HuGE Navigator)
18050197 Primary Sjogren's syndrome and systemic lupus erythematosus share IRF gene polymorphisms as a common genetic susceptibility factor.
17881657 An insertion-deletion polymorphism in the interferon regulatory Factor 5 (IRF5) gene confers risk of inflammatory bowel diseases.
17881657 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17609264 Epstein-Barr virus initially uses TLR7 signaling to enhance B-cell proliferation and subsequently modifies the pathway to regulate IRF-5 activity.
17599733 Observational study of gene-disease association. (HuGE Navigator)
17599733 Genetic variants of IRF5 contribute to a unique disease etiology and pathogenesis in rheumatoid arthritis patients/
17568788 Observational study of gene-disease association. (HuGE Navigator)
17568788 results help to understand the role of the IRF5 locus in SLE (systemic lupus erythematosus)susceptibility by clearly separating protection from susceptibility as caused by independent polymorphisms
17557928 Observational study of gene-disease association. (HuGE Navigator)
17557928 functional IRF5 variations do not confer an obvious risk for type 1 diabetes
17476532 Observational study of gene-disease association. (HuGE Navigator)
17476532 IRF5 could be involved in the more active disease and organ involvement known to occur among Mexican SLE patients.
17412832 Assessment of three functional IRF5 alleles in patients with systemic lupus erythematosus illustrates how multiple common variants of the same gene can together influence the levels of risk of a common disease.
17393452 Observational study of gene-disease association. (HuGE Navigator)
17393452 A structural insertion/deletion in the IRF5 gene leads to expression of specific isoforms in the risk haplotype associated with system lupus erythematosus.
17389033 Observational study of gene-disease association. (HuGE Navigator)
17389033 the genetic effect on the risk of systemic lupus erythematosus mediated by IRF5 variants can be generally accepted in both white and Asian populations
17189288 we show an association of systemic lupus erythematosus with 2 SNPs in the first intron; data support new mechanism by which an IRF5 polymorphism controls expression of alternate transcript variants which may have different effects on interferon signalling
17166181 Observational study of gene-disease association. (HuGE Navigator)
17166181 results in an independent case-control sample confirm the robust association of the IRF5/rs2004640 T allele with SLE risk, and further support the relevance of the type I interferon system in the pathogenesis of SLE and autoimmunity
17158136 results exclude the IRF5 rs2004640-T allele as a major genetic factor for rheumatoid arthritis in this French Caucasian population
17133578 Observational study of gene-disease association. (HuGE Navigator)
17133578 Our results suggest that the IRF5 functional polymorphisms analyzed do not seem to be implicated in genetic susceptibility to rheumatoid arthritis.
16642019 Observational study of gene-disease association. (HuGE Navigator)
16642019 a common IRF5 haplotype driving elevated expression of multiple unique isoforms of IRF5 is an important genetic risk factor for SLE, establishing a causal role for type I IFN pathway genes in human autoimmunity
15805103 there are multiple IRF5 isoforms with distinct cell type-specific expression, localization, regulation, and function
15695821 IRF5 and IRF7 are critical mediators of TLR7 signaling
15657875 Observational study of gene-disease association. (HuGE Navigator)
15657875 identified IRF5 SNPs that displayed strong signals in joint analysis of linkage and association (unadjusted P<10(-7)) with SLE
15556946 CRM1-dependent nuclear export pathway is involved in the regulation of IRF-5 subcellular localization
15308637 IRF-5-and IRF-7-induced innate antiviral response results in a broad alteration of the transcriptional profile of cellular genes
14559832 IRF-5 is a downstream target of p53and its growth inhibitory and proapoptotic effects are independent of p53.
12600985 IRF-5 can act as both an activator and a repressor of interferon gene induction dependent on the IRF-interacting partner, and IRF-5 may be a part of the regulatory network that ensures timely expression of the immediate early inflammatory genes
12138184 this study defines the regulatory phosphorylation sites that control the activity of IRF-5 in Newcastle disease virus-infected cells and provides further insight into its structure and function

AA Sequence

MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKE      1 - 70
TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGA     71 - 140
GEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGF    141 - 210
RELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLE    211 - 280
ATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPC    281 - 350
ASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVP    351 - 420
VAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPW    421 - 490
PMHPAGMQ                                                                  491 - 498
//

Text Mined References (199)

PMID Year Title
27092776 2016 A Combination of CD28 (rs1980422) and IRF5 (rs10488631) Polymorphisms Is Associated with Seropositivity in Rheumatoid Arthritis: A Case Control Study.
26613957 2016 IRF5 and IRF8 modulate the CAL-1 human plasmacytoid dendritic cell line response following TLR9 ligation.
26519527 2015 Sex Differences in Plasmacytoid Dendritic Cell Levels of IRF5 Drive Higher IFN-? Production in Women.
26294277 2015 Genetic association and interaction between the IRF5 and TYK2 genes and systemic lupus erythematosus in the Han Chinese population.
26233721 2015 Association of the IRF5 rs2070197 polymorphism with systemic lupus erythematosus: a meta-analysis.
26112714 2015 Variants of Interferon Regulatory Factor 5 are Associated with Neither Neuromyelitis Optica Nor Multiple Sclerosis in the Southeastern Han Chinese Population.
26004104 2015 Constitutive expression of IRF-5 in HTLV-1-infected T cells.
25649192 2015 A conserved region within interferon regulatory factor 5 controls breast cancer cell migration through a cytoplasmic and transcription-independent mechanism.
25572744 Association of the IRF5 SNP rs2004640 with systemic sclerosis in Han Chinese.
25564941 2015 Association between genetic polymorphisms in interferon regulatory factor 5 (IRF5) gene and Malaysian patients with Crohn's disease.
25557482 2015 Hypermethylation of the interferon regulatory factor 5 promoter in Epstein-Barr virus-associated gastric carcinoma.
25533286 IRF5 is a novel regulator of CXCL13 expression in breast cancer that regulates CXCR5(+) B- and T-cell trafficking to tumor-conditioned media.
25392335 2015 Human interferon regulatory factor 5 homologous epitopes of Epstein-Barr virus and Mycobacterium avium subsp. paratuberculosis induce a specific humoral and cellular immune response in multiple sclerosis patients.
25337792 2014 Genetic association study of TNFAIP3, IFIH1, IRF5 polymorphisms with polymyositis/dermatomyositis in Chinese Han population.
25326420 2014 IKK? is an IRF5 kinase that instigates inflammation.
25326418 2014 Protein kinase IKK?-catalyzed phosphorylation of IRF5 at Ser462 induces its dimerization and nuclear translocation in myeloid cells.
25288773 2014 Mapping of transcription factor motifs in active chromatin identifies IRF5 as key regulator in classical Hodgkin lymphoma.
25284481 2014 IRF5rs2004640 single nucleotide polymorphism is associated with susceptibility to rheumatoid arthritis in South Indian Tamils.
25263394 2014 A large candidate-gene association study suggests genetic variants at IRF5 and PRDM1 to be associated with aggressive periodontitis.
25205108 2015 The IRF5-TNPO3 association with systemic lupus erythematosus has two components that other autoimmune disorders variably share.
25084355 2014 TRIpartite motif 21 (TRIM21) differentially regulates the stability of interferon regulatory factor 5 (IRF5) isoforms.
25036352 2014 Association between IRF5 polymorphisms and autoimmune diseases: a meta-analysis.
25011482 2014 Interferon regulatory factor 5 genetic variants are associated with cardiovascular disease in patients with rheumatoid arthritis.
24943672 2014 Prediction of response to interferon therapy in multiple sclerosis.
24928322 2014 IRF5-mediated signaling and implications for SLE.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24788560 2014 Genetic polymorphism of interferon regulatory factor 5 (IRF5) correlates with allograft acute rejection of liver transplantation.
24697591 Association of interferon regulatory factor 5 (IRF5) markers with an increased risk of lupus and overlapping autoimmunity in a Kuwaiti population.
24697319 2014 Gene-gene interactions of IRF5, STAT4, IKZF1 and ETS1 in systemic lupus erythematosus.
24582590 2014 Lack of association of IRF5 gene polymorphisms with autoimmune thyroid disease: a case-control study. IRF5 gene and AITD.
24532789 2014 HIV-2 Vpx protein interacts with interferon regulatory factor 5 (IRF5) and inhibits its function.
24445143 2014 IRF5 is a target of BCR-ABL kinase activity and reduces CML cell proliferation.
24350899 2014 Molecular effects of autoimmune-risk promoter polymorphisms on expression, exon choice, and translational efficiency of interferon regulatory factor 5.
24116155 2013 Two functional variants of IRF5 influence the development of macular edema in patients with non-anterior uveitis.
24014567 2013 A redundant epistatic interaction between IRF5 and STAT4 of the type I interferon pathway in susceptibility to lupus and rheumatoid arthritis.
23990993 2013 Cyclosporin a inhibits rotavirus replication and restores interferon-beta signaling pathway in vitro and in vivo.
23985571 2013 Association of IRF5 polymorphism with MPO-ANCA-positive vasculitis in a Japanese population.
23971939 2013 IRF5, but not TLR4, DEFB1, or VDR, is associated with the risk of ulcerative colitis in a Han Chinese population.
23941291 2013 Identification of three new cis-regulatory IRF5 polymorphisms: in vitro studies.
23883595 2013 Interferon regulatory factor 5 and autoimmune lupus.
23801380 2013 Association of the IRF5 rs2004640 polymorphism with rheumatoid arthritis: a meta-analysis.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23616277 2013 IRF-5 and NF-?B p50 co-regulate IFN-? and IL-6 expression in TLR9-stimulated human plasmacytoid dendritic cells.
23392701 2013 Association of rs10954213 polymorphisms and haplotype diversity in interferon regulatory factor 5 with systemic lupus erythematosus: a meta-analysis.
23372721 2013 The systemic lupus erythematosus IRF5 risk haplotype is associated with systemic sclerosis.
23349905 2013 RNA-Seq for enrichment and analysis of IRF5 transcript expression in SLE.
23302156 Methylation profile of the promoter region of IRF5 in primary Sjögren's syndrome.
23288367 2013 Interferon regulatory factor 5 polymorphisms in sarcoidosis.
23275442 2013 The COP9 signalosome interacts with and regulates interferon regulatory factor 5 protein stability.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23236436 2012 Gene-gene and gene-sex epistatic interactions of MiR146a, IRF5, IKZF1, ETS1 and IL21 in systemic lupus erythematosus.
23154183 2013 Regulation of cooperative function of the Il12b enhancer and promoter by the interferon regulatory factors 3 and 5.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23073787 2013 Associations between interferon regulatory factor 5 polymorphisms and rheumatoid arthritis: a meta-analysis.
23053960 2012 Genome-wide pathway analysis of genome-wide association studies on systemic lupus erythematosus and rheumatoid arthritis.
22909381 2012 IRF5 gene polymorphisms in melanoma.
22816737 2012 High-throughput sequencing analysis of the chromosome 7q32 deletion reveals IRF5 as a potential tumour suppressor in splenic marginal-zone lymphoma.
22730365 2013 Genome-wide profiling of target genes for the systemic lupus erythematosus-associated transcription factors IRF5 and STAT4.
22674082 2012 Brief Report: IRF5 systemic lupus erythematosus risk haplotype is associated with asymptomatic serologic autoimmunity and progression to clinical autoimmunity in mothers of children with neonatal lupus.
22544929 2012 IRF5 risk polymorphisms contribute to interindividual variance in pattern recognition receptor-mediated cytokine secretion in human monocyte-derived cells.
22507190 2012 IRF5 promotes the proliferation of human thyroid cancer cells.
22500098 2012 Effects of IRF5 lupus risk haplotype on pathways predicted to influence B cell functions.
22440820 2012 IRF5 polymorphism predicts prognosis in patients with systemic sclerosis.
22412986 2012 Activation of interferon regulatory factor 5 by site specific phosphorylation.
22257839 2012 A two-marker haplotype in the IRF5 gene is associated with inflammatory bowel disease in a North American cohort.
22194884 2011 Epigenetic silencing of IRF7 and/or IRF5 in lung cancer cells leads to increased sensitivity to oncolytic viruses.
22179739 2012 Interferon regulatory factor 5 gene polymorphism confers risk to several rheumatic diseases and correlates with expression of alternative thymic transcripts.
22088620 2012 IRF5 haplotypes demonstrate diverse serological associations which predict serum interferon alpha activity and explain the majority of the genetic association with systemic lupus erythematosus.
22053985 2011 Loss of interferon regulatory factor 5 (IRF5) expression in human ductal carcinoma correlates with disease stage and contributes to metastasis.
22025054 2011 Transcriptional regulation of macrophage polarization: enabling diversity with identity.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21968701 2012 Interferon regulatory factor 5 activation in monocytes of systemic lupus erythematosus patients is triggered by circulating autoantigens independent of type I interferons.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21898142 2011 Association of IRF5 polymorphisms with susceptibility to hemophagocytic lymphohistiocytosis in children.
21834935 2011 A meta-analysis of the association of IRF5 polymorphism with systemic lupus erythematosus.
21807777 2011 Preferential association of interferon regulatory factor 5 gene variants with seronegative rheumatoid arthritis in 2 Swedish case-control studies.
21779181 2011 Identification of novel genetic markers associated with clinical phenotypes of systemic sclerosis through a genome-wide association strategy.
21750679 2011 Genome-wide scan identifies TNIP1, PSORS1C1, and RHOB as novel risk loci for systemic sclerosis.
21627826 2011 Cis-regulation of IRF5 expression is unable to fully account for systemic lupus erythematosus association: analysis of multiple experiments with lymphoblastoid cell lines.
21471993 2011 Interferon regulatory factor 5 gene variants and pharmacological and clinical outcome of Interferon? therapy in multiple sclerosis.
21454650 2011 Interferon regulatory factor 4 (IRF-4) targets IRF-5 to regulate Epstein-Barr virus transformation.
21408207 2011 Differential genetic associations for systemic lupus erythematosus based on anti-dsDNA autoantibody production.
21399635 2011 Genome-wide association study identifies 12 new susceptibility loci for primary biliary cirrhosis.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21239750 2011 Association of IRF5 polymorphisms with susceptibility to macrophage activation syndrome in patients with juvenile idiopathic arthritis.
21156761 2011 A genome-wide association study suggests contrasting associations in ACPA-positive versus ACPA-negative rheumatoid arthritis.
21133648 2011 Modulation of interferon regulatory factor 5 activities by the Kaposi sarcoma-associated herpesvirus-encoded viral interferon regulatory factor 3 contributes to immune evasion and lytic induction.
21040166 2010 Association of IRF5 gene polymorphisms and lupus nephritis in a Chinese population.
20980283 2011 The interferon regulatory factor 5 gene confers susceptibility to rheumatoid arthritis and influences its erosive phenotype.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20935208 2010 Differential requirement of histone acetylase and deacetylase activities for IRF5-mediated proinflammatory cytokine expression.
20881011 2011 Early disease onset is predicted by a higher genetic risk for lupus and is associated with a more severe phenotype in lupus patients.
20861862 2011 Validation of IRF5 as multiple sclerosis risk gene: putative role in interferon beta therapy and human herpes virus-6 infection.
20861858 2011 Association of EBF1, FAM167A(C8orf13)-BLK and TNFSF4 gene variants with primary Sjögren's syndrome.
20848568 2010 Genetically determined Amerindian ancestry correlates with increased frequency of risk alleles for systemic lupus erythematosus.
20797713 2011 Endometriosis and autoimmune disease: association of susceptibility to moderate/severe endometriosis with CCL21 and HLA-DRB1.
20695768 2011 Exon 6 variants carried on systemic lupus erythematosus (SLE) risk haplotypes modulate IRF5 function.
20639880 2010 Genome-wide meta-analyses identify three loci associated with primary biliary cirrhosis.
20639879 2010 Variants at IRF5-TNPO3, 17q12-21 and MMEL1 are associated with primary biliary cirrhosis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20616560 2010 Genetic differences between five European populations.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20479942 2010 Genetic risk factors in lupus nephritis and IgA nephropathy--no support of an overlap.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
20453440 2010 Association of IRF5, STAT4 and BLK with systemic lupus erythematosus and other rheumatic diseases.
20439292 2010 Genetic variants in the prediction of rheumatoid arthritis.
20383147 2010 Genome-wide association study of systemic sclerosis identifies CD247 as a new susceptibility locus.
20351107 2010 Differential gene expression downstream of Toll-like receptors (TLRs): role of c-Src and activating transcription factor 3 (ATF3).
20237317 2010 IRF5 is required for late-phase TNF secretion by human dendritic cells.
20231204 2010 Phenotype-haplotype correlation of IRF5 in systemic sclerosis: role of 2 haplotypes in disease severity.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20197570 2010 Lack of interaction between systemic lupus erythematosus-associated polymorphisms in TYK2 and IRF5.
20137629 2009 [Relationship between polymorphism sites of IRF5, TLR-9 and SLE patients in Shandong Han population].
20131273 2010 IRF5 is associated with primary antiphospholipid syndrome, but is not a major risk factor.
20127100 2010 Assessment of DNA methylation at the interferon regulatory factor 5 (IRF5) promoter region in inflammatory bowel diseases.
20112383 2010 Genetic variants and disease-associated factors contribute to enhanced interferon regulatory factor 5 expression in blood cells of patients with systemic lupus erythematosus.
20090783 2010 Variant IRF4/MUM1 associates with CD38 status and treatment-free survival in chronic lymphocytic leukaemia.
20080916 2010 Promoter insertion/deletion in the IRF5 gene is highly associated with susceptibility to systemic lupus erythematosus in distinct populations, but exerts a modest effect on gene expression in peripheral blood mononuclear cells.
20049410 2010 A functionally relevant IRF5 haplotype is associated with reduced risk to Wegener's granulomatosis.
20015215 2010 Polymorphisms in genes involved in autoimmune disease and the risk of FVIII inhibitor development in Italian patients with haemophilia A.
19918036 2010 Lack of association between IRF5 gene polymorphisms and biopsy-proven giant cell arteritis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19877059 2009 BANK1 is a genetic risk factor for diffuse cutaneous systemic sclerosis and has additive effects with IRF5 and STAT4.
19854706 2010 Association of IRF5 polymorphisms with activation of the interferon alpha pathway.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19838193 2009 Genome-wide association study in a Chinese Han population identifies nine new susceptibility loci for systemic lupus erythematosus.
19816589 2009 Lack of association of two polymorphisms of IRF5 with Behcet's disease.
19786094 2010 IKKalpha negatively regulates IRF-5 function in a MyD88-TRAF6 pathway.
19778284 2010 Association between IRF-5 polymorphisms and risk of acute coronary syndrome.
19758313 2010 Tyrosine kinase 2 and interferon regulatory factor 5 polymorphisms are associated with discoid and subacute cutaneous lupus erythematosus.
19644887 2009 STAT4 is a genetic risk factor for systemic sclerosis having additive effects with IRF5 on disease susceptibility and related pulmonary fibrosis.
19644876 2009 Association of STAT4 and BLK, but not BANK1 or IRF5, with primary antiphospholipid syndrome.
19567624 2009 Evidence for genetic association and interaction between the TYK2 and IRF5 genes in systemic lupus erythematosus.
19565491 2009 The CGGGG insertion/deletion polymorphism of the IRF5 promoter is a strong risk factor for primary Sjögren's syndrome.
19479858 2009 Association of a functional polymorphism in the IRF5 region with systemic sclerosis in a Japanese population.
19430534 2009 Functional analysis of a dominant negative mutation of interferon regulatory factor 5.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19228650 2009 Association of polymorphisms in interferon regulatory factor 5 gene with rheumatoid arthritis: a metaanalysis.
19129183 2009 The Kaposi's Sarcoma-associated Herpesvirus-encoded vIRF-3 Inhibits Cellular IRF-5.
19116937 2009 Association between the IRF5 rs2004640 functional polymorphism and systemic sclerosis: a new perspective for pulmonary fibrosis.
19092842 2009 Additive effects of the major risk alleles of IRF5 and STAT4 in primary Sjögren's syndrome.
19043711 2009 Association between the rs2004640 functional polymorphism of interferon regulatory factor 5 and systemic lupus erythematosus: a meta-analysis.
19028697 2009 IRF-5 is a mediator of the death receptor-induced apoptotic signaling pathway.
19019891 2009 STAT4 associates with systemic lupus erythematosus through two independent effects that correlate with gene expression and act additively with IRF5 to increase risk.
18843785 2008 Putative role of functional interferon regulatory factor 5 (IRF5) polymorphism in rheumatoid arthritis in a Korean population.
18843782 2008 Different genetic effects of interferon regulatory factor 5 (IRF5) polymorphisms on systemic lupus erythematosus in a Korean population.
18836453 2008 Insights into interferon regulatory factor activation from the crystal structure of dimeric IRF5.
18824541 2008 Functional regulation of MyD88-activated interferon regulatory factor 5 by K63-linked polyubiquitination.
18752149 Association of IRF5 gene polymorphisms with rheumatoid arthritis in a Tunisian population.
18668568 2008 Association of the IRF5 risk haplotype with high serum interferon-alpha activity in systemic lupus erythematosus patients.
18579578 2008 A risk haplotype of STAT4 for systemic lupus erythematosus is over-expressed, correlates with anti-dsDNA and shows additive effects with two risk alleles of IRF5.
18505922 2008 Interferon regulatory factors IRF5 and IRF7 inhibit growth and induce senescence in immortal Li-Fraumeni fibroblasts.
18438842 2008 Association of interferon regulatory factor 5 haplotypes, similar to that found in systemic lupus erythematosus, in a large subgroup of patients with rheumatoid arthritis.
18408250 2009 A single nucleotide polymorphism in the IRF5 promoter region is associated with susceptibility to rheumatoid arthritis in the Japanese population.
18332133 2008 Functional characterization of murine interferon regulatory factor 5 (IRF-5) and its role in the innate antiviral response.
18323517 2008 Variants of the interferon regulatory factor 5 gene regulate expression of IRF5 mRNA in atherosclerotic tissue but are not associated with myocardial infarction.
18311811 2008 Association of IRF5 polymorphisms with systemic lupus erythematosus in a Japanese population: support for a crucial role of intron 1 polymorphisms.
18288123 2008 Interferon regulatory factor-5 is genetically associated with systemic lupus erythematosus in African Americans.
18285424 2008 Interferon regulatory factor 5 (IRF5) gene variants are associated with multiple sclerosis in three distinct populations.
18260169 2008 Association of a haplotype of IRF5 gene with systemic lupus erythematosus in Chinese.
18204446 2008 Genome-wide association scan in women with systemic lupus erythematosus identifies susceptibility variants in ITGAM, PXK, KIAA1542 and other loci.
18204098 2008 Association of systemic lupus erythematosus with C8orf13-BLK and ITGAM-ITGAX.
18200047 2008 IFN-regulatory factor 5 gene variants interact with the class I MHC locus in the Swedish psoriasis population.
18063667 2008 Comprehensive evaluation of the genetic variants of interferon regulatory factor 5 (IRF5) reveals a novel 5 bp length polymorphism as strong risk factor for systemic lupus erythematosus.
18050197 2007 Association of an IRF5 gene functional polymorphism with Sjögren's syndrome.
17881657 2007 An insertion-deletion polymorphism in the interferon regulatory Factor 5 (IRF5) gene confers risk of inflammatory bowel diseases.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17609264 2007 Manipulation of the toll-like receptor 7 signaling pathway by Epstein-Barr virus.
17599733 2007 Association of a haplotype in the promoter region of the interferon regulatory factor 5 gene with rheumatoid arthritis.
17568788 2007 Opposed independent effects and epistasis in the complex association of IRF5 to SLE.
17557928 2007 The IRF5 polymorphism in type 1 diabetes.
17476532 2007 Genetic association of IRF5 with SLE in Mexicans: higher frequency of the risk haplotype and its homozygozity than Europeans.
17412832 2007 Three functional variants of IFN regulatory factor 5 (IRF5) define risk and protective haplotypes for human lupus.
17393452 2007 Structural insertion/deletion variation in IRF5 is associated with a risk haplotype and defines the precise IRF5 isoforms expressed in systemic lupus erythematosus.
17389033 2007 Replication of the genetic effects of IFN regulatory factor 5 (IRF5) on systemic lupus erythematosus in a Korean population.
17189288 2007 Association of IRF5 in UK SLE families identifies a variant involved in polyadenylation.
17166181 2007 Association of a common interferon regulatory factor 5 (IRF5) variant with increased risk of systemic lupus erythematosus (SLE).
17158136 2007 IRF5 rs2004640-T allele, the new genetic factor for systemic lupus erythematosus, is not associated with rheumatoid arthritis.
17133578 2006 Analysis of IRF5 gene functional polymorphisms in rheumatoid arthritis.
17121613 2006 Mapping of nine porcine interferon regulatory factor genes.
16642019 2006 A common haplotype of interferon regulatory factor 5 (IRF5) regulates splicing and expression and is associated with increased risk of systemic lupus erythematosus.
15805103 2005 Two discrete promoters regulate the alternatively spliced human interferon regulatory factor-5 isoforms. Multiple isoforms with distinct cell type-specific expression, localization, regulation, and function.
15695821 2005 The interferon regulatory factor, IRF5, is a central mediator of toll-like receptor 7 signaling.
15665823 2005 Integral role of IRF-5 in the gene induction programme activated by Toll-like receptors.
15657875 2005 Polymorphisms in the tyrosine kinase 2 and interferon regulatory factor 5 genes are associated with systemic lupus erythematosus.
15556946 2005 A CRM1-dependent nuclear export pathway is involved in the regulation of IRF-5 subcellular localization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308637 2004 Global and distinct targets of IRF-5 and IRF-7 during innate response to viral infection.
14559832 2003 Interferon regulatory factor 5, a novel mediator of cell cycle arrest and cell death.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12600985 2003 Virus-induced heterodimer formation between IRF-5 and IRF-7 modulates assembly of the IFNA enhanceosome in vivo and transcriptional activity of IFNA genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12138184 2002 Multiple regulatory domains of IRF-5 control activation, cellular localization, and induction of chemokines that mediate recruitment of T lymphocytes.
11997525 2002 A novel interferon regulatory factor (IRF), IRF-10, has a unique role in immune defense and is induced by the v-Rel oncoprotein.
11846976 2002 On the role of IRF in host defense.
11303025 2001 Virus-specific activation of a novel interferon regulatory factor, IRF-5, results in the induction of distinct interferon alpha genes.
9865487 Role of the interferon regulatory factors (IRFs) in virus-mediated signaling and regulation of cell growth.