Property Summary

NCBI Gene PubMed Count 277
PubMed Score 596.62
PubTator Score 524.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... 1.235 6.1e-03

Gene RIF (234)

PMID Text
26819312 the suppression of type I IFN production by HTLV-1 Tax through interaction with and inhibition of TBK1 kinase that phosphorylates IRF3
26811330 FAF1 plays a novel role in negatively regulating virus-induced IFN-beta production and the antiviral response by inhibiting the translocation of active, phosphorylated IRF3 from the cytosol to the nucleus
26719279 The authors found that Ca(2+) signaling associated with membrane perturbation and recognition of incoming viral genomes by cytosolic nucleic acid receptors are required to activate IRF3 in response to Sendai virus and human cytomegalovirus.
26692175 Study identifies crosstalk between PTEN and IRF3 in tumor suppression and innate immunity.
26611114 observations suggest IRF3 may function as a novel regulator to modulate TGF-beta1-induced LX-2 proliferation, at least in part, via AKT signaling pathway
26289783 the LxxLL motifs of IRF3 binds within the hydrophobic pocket of E6, precluding Ser-patch phosphorylation, necessary for IRF3 activation and interferon induction.
26216125 The identification of IRF3 deficiency in HSE provides the first description of a defect in an IFN-regulating transcription factor conferring increased susceptibility to a viral infection in the CNS in humans.
26058929 The expression levels of IRF3 were not different between CHB patients and healthy controls.
25893288 TEL-AML1 fusion protein blocks B-cell differentiation and downregulates the IRF3-IFNalpha/beta pathway by modulating expression and phosphorylation of IRF3 in human primary hematopoietic precursor cells.
25843157 The results of this study suggested that IRF3 is likely a risk gene for schizophrenia, at least in Caucasians.
25811886 results revealed a new paradigm in which the antiviral host factor, IRF3, plays a cell-intrinsic pro-parasitic role.
25712217 study demonstrates HSV-2 US1 inhibits production of IFN-beta by suppressing activation of IFN-beta promoter by interfering with the association of nuclear IRF-3 with IRF-3-responsive domain of the the IFN-beta promoter
25636800 results reveal that phosphorylation of innate adaptor proteins is an essential and conserved mechanism that selectively recruits IRF3 to activate the type I IFN pathway
25609812 Collectively, this study characterizes a novel protein complex, Tom70/Hsp90/IRF3/Bax, that is important for Sendai virus-induced apoptosis.
25529283 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
25506707 The present study indicated that HSPD1 interacted with IRF3 and it contributed to the induction of IFN-beta.
25481026 The data show that SARS coronavirus PLpro also inhibits IRF3 activation at a step after phosphorylation and that this inhibition is dependent on the de-ubiquitination (DUB) activity of PLpro.
25444175 The presence of TLR3 and IRF-3 in both human normal and PCa clinical samples, potentially envisaging poly I:C-based therapy for PCa.
25352594 Data suggest that Vpu accessory protein contributes to the attenuation of the anti-viral response by partial inactivation of interferon regulatory factor 3 (IRF3) while host cells undergo apoptosis.
25352594 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
25232931 induction of miR-576-3p by IRF3 triggers a feedback mechanism to reduce interferon expression and set an antiviral response threshold to likely avoid excessive inflammation
25159465 Inhibition of the IRF3 and IRF7 innate immune pathways in patients with atopic dermatitis with a history of eczema herpeticum might be an important mechanism for increased susceptibility to disseminated viral infection.
25130328 The IRF3 rs2304204 GG and AG genotypes conferred decreased risk for systemic lupus erythematosus (SLE).
24879293 The function of IRF3 is a critical node in TLR signaling pathways, which is central for the induction of important polarizing cytokines.
24872591 This binding sequesters the association between TBK1 and IRF3.
24807717 Human herpesvirus 1 ICP0 blocks the activation of interferon regulatory factor 3 (IRF3) in a mechanism that requires the RING finger domain but not the proteasome.
24807708 Authors found that RIOK3 physically interacts with TBK1 and IRF3 and bridges the functions between TBK1 and IRF3 in the activation of type I interferon pathway.
24800889 stable activation during respiratory syncytial virus infection requires both RIG-1 and MDA5
24726876 these studies reveal that RACK1-PP2A-mediated dephosphorylation is essential for the termination of active IRF3, which may help in the development of novel therapeutic strategies for type I IFN deregulation.
24722640 Our results demonstrate for the first time that IRF3 and IRF7 are both involved in inducing TLR4-dependent IFN-beta expression in response to HSV-2 in its primary infected genital epithelial cells
24535579 These results suggested that Rta represses IRF-3 expression by increasing E2F1 binding to the IRF-3 promoter.
24531619 Viral infection induced DAPK1-IRF7 and DAPK1-IRF3 interactions and overexpression of DAPK1 enhanced virus-induced activation of the interferon-stimulated response element (ISRE) and IFN-beta promoters and the expression of the IFNB1 gene.
24385435 Interferon regulatory factor (IRF)-3 and -7 are the key transcriptional factors for the induction of IL-28A and IL-28B genes, whereas NF-kappaB is an additional requirement for the induction of the IL-29 gene.
24335286 Through interaction with TBK1, phlebovirus nonstructural protein sequester the IKKepsilon and IRF3 into viral inclusion bodies.
24275658 MAP3K8 mediates the phosphorylation and repression of IRF3 homodimers to promote greater transcriptional activity through utilization of IRF3:IRF7 heterodimers.
24275652 Data indicate that blockade of CD14 inhibits TLR4 internalization, spleen tyrosine kinase (Syk) phosphorylation and IRF3 signaling in epithelial cells.
24257594 NF-kappaB and IRF3 activated the CXCL10 promoter independently of type I or type III IFN signaling during hepatitis C virus infection.
24196714 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
24196705 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
24049179 Herpes simplex virus 1 US3 hyperphosphorylates IRF3 and inhibits beta interferon production.
24036127 Further study indicated that PIAS1 interacted with IRF3 and inhibited the DNA binding activity of IRF3.
23994473 Results reveal extensive integration of IRF3 and NFkappaB with Pol II and associated machinery and implicate partners for antiviral transcription.
23929945 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
23824799 HSV-1 VP16 is able to block tp65 he production of IFN-beta by inhibiting NF-kappaB activation and interfering with IRF-3 to recruit its coactivator CBP, which may be important to the early events leading to HSV-1 infection.
23755934 Japanese encephalitis virus non-coding RNA inhibits activation of interferon beta by blocking nuclear translocation of IRF3.
23650567 Overexpression of the MDA5 protein reverses the suppression of IRF3 activation caused by EV71 infection.
23649622 Data indicate that suppressor of IKKepsilon (SIKE) inhibits TANK-binding kinase 1 (TBK1)-mediated phosphorylation of interferon regulatory factor 3 (IRF3), which is essential to type I interferon production.
23596302 These data indicate that transcription elongation plays a major role in RSV-induced ISG expression and is mediated by IRF3-dependent recruitment of activated CDK9.
23552418 Vpu does not deplete IRF-3 from transfected cell lines or HIV-1-infected primary cells.
23542224 Study analyzed two gene variants in IRF3 (rs7251 and rs2304205) on the clinical outcome of 249 AML patients submitted to HLA-identical sibling allo-SCT.
23532851 FoxO1 negatively regulates cellular antiviral response by promoting IRF3 ubiquitination and degradation, providing a previously unknown mechanism for control of type I IFN induction and cellular antiviral response.
23512614 Loss of Interferon regulatory factor 3 is associated with inflammation and invasiveness in glioma.
23478265 DDX3 is a scaffolding adaptor that directly facilitates phosphorylation of IRF3 by IKK-epsilon.
23303668 Chlamydia pneumoniae infection blocks type I interferon induction by preventing phosphorylation and nuclear translocation of IRF3.
23281696 Ultraviolet radiation also upregulated mitogen-activated protein kinases and nuclear factor-kappaB/p65 expression via Toll-like receptor 2 and Toll-like receptor 4, and upregulated interferon regulatory factor-3 expression
23154183 The dual commitment of IRF3 and IRF5 in the regulation of the Il12b enhancer and promoter is unique and may have implications for understanding the evolution of this gene.
23122814 this study revealed a crucial region of the HCV core protein, basic amino acid region 1 (BR1), to inhibit IRF-3 dimerization as well as its phosphorylation induced by NDV infection and poly (I:C), thus interfering with IRF-3 activation.
23077293 The key proapoptotic protein in this pathway is interferon regulatory factor 3 (IRF-3), which upon activation by Sendai virus infection binds BAX, translocates it to mitochondria, and triggers apoptosis.
23027953 An unknown factor must be exported from the nucleus to activate IRF-3 through cytoplasmic STING, which is required for IRF-3 activation and signaling
22906770 LPS and PCB coadministration disrupts the blood-brain barrier through activating TLR4 and and IRF3.
22843696 ATF2-Jun heterodimers bind IFNb in both orientations alone and in association with IRF3 and HMGI
22745372 Bocavirus nonstructural protein (NP)1 interacts with the DNA-binding domain of human IRF-3 and blocks its association with interferon (IFN)beta promoter.
22709905 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
22705311 Monoclonal antibodies to human IRF-3 detect IRF-3 in virus-infected cells in a wide variety of assays, providing a new tool to study virus-host interactions and innate immune signaling.
22647704 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
22593165 The authors define a molecular interaction between Vpu and IRF3 that redirects IRF3 to the endolysosome for proteolytic degradation, thus allowing HIV to avoid the innate antiviral immune response.
22593165 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
22479513 analysis of a novel role for tyrosine phosphorylation in regulating the interaction with IRF3 and the activity of TRIM21 downstream of TLR3 and TLR4
22394562 results suggest that STING functions as a scaffold protein to specify and promote the phosphorylation of IRF3 by TBK1.
22394560 study now shows that in response to cytosolic double-stranded DNA, the C-terminal tail of STING provides a scaffold to assemble IRF3 and TBK1, which leads to TBK1-dependent phosphorylation of IRF3
22307793 A spliced variant of human IRF-3 gene core promoter was identified within the region -159/-100 relative to the transcription start site.
22294846 Data sugges that the three tag single nucleotide polymorphisms of IRF3 are not associated with HBV infection in the Han Chinese population.
22208359 Results show a novel anti-inflammatory role for the PI3K/Akt signaling pathway in microglia, and show that Ad-IRF3 suppressed proinflammatory genes and enhanced anti-inflammatory genes.
22170100 Our results demonstrate a novel proinflammatory role for miR-155/miR-155* in human astrocytes and suggest that IRF3 can suppress neuroinflammation through regulating immunomodulatory miRNA expression.
22158869 a novel role of the PLCgamma2-IP(3)-Ca(2+) cascade in the LPS-induced innate immune response pathway where release of intracellular Ca(2+) mediates TLR4 trafficking and subsequent activation of IRF3.
22127978 Patients with SLE display enhanced IL-23p19 expression as a result of hyperactivation of TBK-1, resulting in increased binding of IRF-3 to the promoter.
22028379 Data suggest that SENP2 regulates antiviral innate immunity by deSUMOylating IRF3 and conditioning it for ubiquitination and degradation, and provide an example of cross-talk between the ubiquitin and SUMO pathways in innate immunity.
22027828 HDAC3 regulates galectin-9 expression in endothelial cells via interaction with PI3K-IRF3 signal pathway
21935451 SNPs in IRF3 (OR 0.54, p = 0.035) and MX1, (OR 0.19, p = 0.014) were associated with symptomatic WNV infection.
21931555 Vaccinia virus protein C6 prevents the nuclear translocation of IRF3.
21886773 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
21859832 Single nucleotide polymorphism in IRF3 gene is associated with colon cancer.
21835786 These results convincingly demonstrate that varicella-zoster virus ORF61 down-modulates the IRF3-mediated IFN-beta pathway by degradation of activated human IRF3 via direct interaction.
21816816 Caspase-8-mediated cleavage of IRF-3 helps to modulate dsRNA-dependent gene induction.
21768204 Here we show strong phosphorylation of IRF3, and an increase in mRNA levels for antiviral genes interferon stimulated gene (ISG)56 and interferon gamma inducible protein
21698224 A pathway leading from the detection of viral RNA during modified vaccinia virus infection by the cytosolic helicase-pathway, to the up-regulation of Noxa and apoptosis via IRF3 and type I IFN signalling.
21632562 In this study, the authors found that NS1 protein inhibits IRF-3-dependent gene transcription in constitutively active IRF-3 overexpressing cells, demonstrating that NS1 directly targets IRF-3.
21497908 data suggested that PI3K/AKT pathway contributes to influenza A virus induced CXCL-10 production; this process is involved in binding of IRF3 to the ISRE binding site in CXCL-10 promoter region
21468605 Ultraviolet light up-regulates the expression of TLR2, TLR4 and downstream signaling molecules MAPK, NF-kappaB/p65 and IRF-3 in human Langerhans cells.
21419663 Conjugation of ubiquitin chains to RIP1 facilitated assembly of the RIG-I complex, resulting in enhanced phosphorylation of IRF3
21411754 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
21347389 ORF47p is involved in the atypical phosphorylation of IRF3 during VZV infection
21281747 five novel splicing variants of IRF-3, referred to as IRF-3b, -3c, -3d, -3e, and -3f, were identified and shown to be generated by deletion of exons 2, 3, or 6 or some combination thereof
21248248 A new role for MyD88 restricts Toll-like receptor (TLR)3 signaling through a hitherto unknown mechanism whereby MyD88 impairs IkappaB kinaseepsilon-mediated induction of interferon regulatory factor (IRF)3 and concomitant interferon (IFN)-beta and RANTES production.
21245146 identify R(+)WIN55,212-2 as a novel regulator of TLR3 signaling to IRF3 activation and IFN-beta expression
21228327 we propose a model for the rapid induction of IFN-beta in monocytes, whereby IRF8 and PU.1 form a scaffold complex on the IFN-beta promoter to facilitate the recruitment of IRF3
21225257 The transcription factor E2F1 negatively regulates the basal transcriptional activity of IRF-3 and deregulates IRF-3 expression at the mRNA level.
21200386 IRF3-CL, the alternative splicing isoform of IRF-3, may function as a negative regulator of IRF3
21182093 Two splice variants of Ikke form dimers with IKKe-wt and inhibit IKKe-wt-induced IRF3 signaling including the antiviral activity in a dominant-negative manner.
21120614 The discovery of new transcripts of IRF-3 provides a further insight into the alternative splicing of IRF-3.
21084487 Neurovirulence of interferon-resistant rabies virus correlates with the capacity of the virus phosphoprotein to prevent activation of IRF3 and IRF7.
21084468 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
20980500 IRF-3, expressed in all layers of human epidermis, induced strong HPV8 suppression in primary keratinocytes.
20933442 Rab11a is an important regulator of TLR4 and Toll-receptor-associated molecule transport to E. coli phagosomes thereby controlling IRF3 activation from this compartment.
20886096 Polymorphic IRF3 promoter is associated with severe, symptomatic kidney infection.
20826620 These findings suggest that Nsp2 is likely to play an important role in subversion of IRF-3-dependent innate antiviral defences, providing a basis for elucidating the mechanisms underlying PRRSV pathogenesis.
20711230 found that hepatitis B virus (HBV)-encoded X protein (HBx) acts as an inhibitor of virus-triggered IRF3 activation and interferon-beta induction
20631144 IE62 has two critical but discrete roles following varicella zoster virus entry: to induce expression of viral genes and to disarm the interferon-dependent antiviral defense through a novel mechanism that prevents IRF3 phosphorylation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20604809 The phosphorylated IRF-3 regulatory domain (IRF-3 RD) was prepared using the kinase IKK-i, and the active form of phosphorylated IRF-3 RD was identified.
20511230 analysis of a novel in vivo virus-targeted phosphorylation site in interferon regulatory factor-3 (IRF3)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20501320 The aberrant expression of IRF3 and the novel D(208) variant may provide clues to elucidate the etiology of primary lung cancer.
20485298 IRF-3 activated downstream of MAVS can bind to and activate cytosolic Bax, resulting in Bax translocation to the mitochondria and initiation of the intrinsic apoptotic pathway
20483755 IRF3 rather than IRF7 regulates poly (I-C)-induced type I IFN responses in human synoviocytes
20454685 role of ICP0 localization and the requirement of the proteasome during the inhibition of IRF3 activation within the context of an HSV-1 infection
20418377 Data show that mutant TICAM-1 failed to recruit the IRF-3 kinase TBK1, resulting in lack of IRF-3 phosphorylation.
20381110 The authors show that BRLF1 expression decreased induction of IFN-beta, and reduced expression of IRF3 and IRF7.
20380700 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
20380698 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
20360684 Viral apoptosis is induced by IRF-3-mediated activation of Bax
20351107 c-Src modulation and ATF3 activity may contribute to differential regulation of IRF-3- versus IRF-5-mediated gene expression
20331378 Observational study of gene-disease association. (HuGE Navigator)
20308324 This study characterizes HERC5 as a positive regulator of innate antiviral responses, and show that it sustains IRF3 activation via a novel posttranslational modification, ISG15-ylation.
20154210 Chlamydia pneumoniae infection of vascular endothelial cells activates mitochondrial antiviral signaling protein (MAVS), stimulating IRF3- and IRF7-dependent signals controlling bacterial growth and therefore modulating development of vascular lesions.
20048166 Data show that LANA-1 inhibits IFN-beta transcription and synthesis by competing with the binding of interferon regulatory factor-3 (IRF3) to the IFNB promoter.
20048147 ZAP is a direct target gene of IRF3 action in cellular antiviral respon
19956647 an IKKgamma splice variant determines IRF3 and canonical NF-kappaB pathway utilization in ssRNA virus infection
19955181 Activation of IRF3 and IRF3-dependent gene expressions was dependent on TAK1 and TANK-binding kinase 1 (TBK1).
19913121 Observational study of gene-disease association. (HuGE Navigator)
19890046 TLR3 and MDA5, but not RIG-I, are required for maximal sensing of rhinovirus dsRNA and that TLR3 and MDA5 signal through a common downstream signaling intermediate, IRF3.
19858727 IRF-3 expression was significantly higher (P< 0.005) among patients of Gr II (73.3%) in comparison with that in Gr I (50%) and Gr III (36.7%).
19854139 Catalytically active Ubc5 is required for IRF3 activation by viral infection.
19826915 E2F1 transcription factor negatively regulates human IRF-3 gene promoter.
19710021 the antiapoptotic activity of ADAR1 is achieved through suppression of activation of proapoptotic and double-stranded RNA-dependent activities, as exemplified by PKR and IRF-3.
19706707 Our results indicate that viral suppression of IRF-3 promotes HIV-1 infection by disrupting IRF-3-dependent signaling pathways and innate antiviral defenses of the host cell.
19701189 After recognition of a viral ssRNA genome, Nod2 used the adaptor protein MAVS to activate IRF3.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19646728 While there was no significant degree of IRF3 activation in HIV-infected microglia, HIV infection causes a decrease in the amount of IRF3.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19553679 vIRF-2 mediates IRF-3 inactivation by a mechanism involving caspase-3.
19515829 Herpes simplex type 1 infection triggered an IRF-3 and IRF-7-dependent antiviral response.
19445677 The interaction between the measles virus nucleoprotein and IRF3 relies on human cellular co-factors.
19434718 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19426920 mRNA levels of primary Sjogren Syndrome patients were not up-regulated
19380831 MspTL, the major outer protein of Treponema lecithinolyticum, induces interferon-stimulated genes in monocytes via TANK-binding kinase 1/IRF-3 signaling secondary to lipid raft activation.
19349300 transient binding of both IRF-3 and IRF-7, accompanied by CBP/p300 recruitment to the endogenous IFN-A gene promoters, is associated with transcriptional activation
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19239434 Neither of the mitogen-activated protein kinases ERK1/2, JNK, or p38 nor the transcription factor interferon regulatory factor 3 were involved in the direct transactivation of HIV-LTR through stimulation of TLR4.
19213861 Observational study of gene-disease association. (HuGE Navigator)
19211751 extent of posttranslational modification observed on IRF3 did not correlate with the degree of subsequent interferon-stimulated gene induction
19201840 carbon monoxide treatment inhibits dendritic cell immunogenicity induced by TLR ligands and that blockade of IFN regulatory factor 3 is associated with this effect
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19153595 The TAK1-JNK cascade is required for interferon regulatory factor 3 function, in addition to Tank binding kinase 1/Ikappa B kinase varepsilon, uncovering a new mechanism for mitogen-activated protein kinase to regulate the innate immunity.
19152337 Altogether, these data further highlight the respective functions of IRF-3 and IRF-7 to program apoptotic, immune and anti-tumor responses.
19124752 IRF3 and p38 MAP kinase separately and predominantly contribute to avian influenza A virus H5N1-mediated induction of interferon (IFN)-beta, IFN-lambda 1 and monocyte chemoattractant protein-1 but only partly control tumor necrosis factor-alpha induction.
19038458 Abundance of IRF-3 protein is a determinant in the polyinosinic:polycytidylic acid-mediated antiviral signalling pathway.
19028691 PKR, in addition to IPS-1 and IRF3 but not TRIF, was required for maximal type I IFN-beta induction and the induction of apoptosis by both transfected PRNAs and polyinosinic-polycytidylic acid.
19017982 a novel TLR-independent pathogen-sensing mechanism in immune and nonimmune cells that converges on TBK1 and IFN regulatory factor 3 for activation of IFN-beta gene expression.
19012493 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18927075 PKR facilitates the host innate immune response and apoptosis in virus-infected cells by mediating IRF-3 activation through the mitochondrial IPS-1 signal transduction pathway
18818105 results suggest MITA is a critical mediator of virus-triggered IRF3 activation and IFN expression and further demonstrate the importance of certain mitochondrial proteins in innate antiviral immunity.
18781139 aberrant splicing of IRF3 in HCC contributes to the defect in IFN-mediated antiviral defenses
18713996 MKK4 activates c-Jun and MKK7 activates both c-Jun and IRF3 through JNK-dependent mechanisms.
18711448 Study shows that the E3 ubiquitin ligase RBCC protein interacting with PKC1 (RBCK1) catalyzes the ubiquitination and degradation of IRF3.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18641315 demonstrates a novel role for Ro52 in turning off and thus limiting IRF3-dependent type I IFN production by targeting the transcription factor for polyubiquitination and subsequent proteasomal degradation
18635538 SUMO modification and RIG-I activation are an integral part of IRF3 and IRF7 activity that contributes to postactivation attenuation of IFN production
18579584 IRF3-dependent pathway is not essenial for repression of ICPO-null mutant herpes simplex virus type 1 in fibroblasts.
18539711 Results show that the promoter single-nucleotide polymorphisms of the IRF3 gene are significantly associated with resistance against systemic lupus erythematosus.
18539711 Observational study of gene-disease association. (HuGE Navigator)
18450748 activation and formation of TICAM-1 signalosomes with NF-kappaB and interferon regulatory factor-3 requires oligomerization induced at two different sites and RIP1 binding
18440553 These results indicate that Ser386 and Ser396 are critical for IRF-3 activation, and support a phosphorylation-oligomerization model for IRF-3 activation.
18362887 Epstein-Barr virus-encoded small RNA induces IL-10 through RIG-I-mediated IRF-3 signaling.
18272581 The study establishes a molecular link between the role of serine 339 in IRF-3 homodimerization, CBP association, and its destabilization.
18272195 Our results indicate that rhinovirus type 14 (RV14) infection interfers with IRF-3 activation.
18252870 Polyinosinic-polycytidylic acid and LPS were used to study type-I IFN and TNF responses in human macrophages which activate IRF3 induction.
18216110 These results demonstrated that IRF-3 controlled the fate of the SeV-infected cells by promoting apoptosis and preventing persistence.
18203148 These results indicate that HCV can transiently trigger IRF-3 activation during virus spread and that in chronic HCV, IRF-3 activation within infected hepatocytes occurs but is limited.
18082865 HIV-1 virion-associated accessory proteins Vif and Vpr can independently degrade IRF-3.
18082865 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
17761676 Data suggest that regulation of IRF-3-dependent innate antiviral defenses by papain-like protease may contribute to the establishment of SARS-CoV infection.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17652396 K-bZIP prevents IRF-3 from binding to the IFN-beta promoter and precludes the formation of the enhanceosome, required for maximal ifn-beta gene transcription
17641046 Sin Nombre virus particles initiate a heretofore unrecognized cellular pattern-recognition receptor by engaging a novel IRF3-independent pathway that activates the innate immune response.
17626075 poly(I:C)induction of IDO was mediated in part by IFN-beta but not IFN-gamma, and both NF-kappaB and interferon regulatory factor 3 (IRF3) were required.
17608743 Results show that IRF3 signalling is inhibited by YopJ.
17560375 structure of IRF-3 DNA binding domain in complex with the complete PRDIII-I regulatory element of the IFN-beta enhancer
17540767 IRF-3 is required for efficient apoptosis following reovirus infection, suggesting a common mechanism of antiviral cytokine induction and activation of the cell death response.
17526488 analysis of a two-step phosphorylation model for IRF-3 activation mediated by TBK1
17449641 TLR3, PI3K, and IRF3 are involved in the poly IC-induced galectin-9 expression in HUVECs
17393359 expression patterns of IRF3 & IRF7 in normal lymph nodes, reactive hyperplastic lymph nodes & pediatric lymphomas; results suggest IRF3 was activated mainly in histiocytes & T cells under inflammatory conditions but activation was attenuated in lymphoma
17328045 Antiviral gene expression in RA, especially due to TLR ligands and TNFalpha, is dependent on IKKepsilon and IRF-3, and this pathway plays a key role in the production of type I IFNs and chemokines such as RANTES.
17251580 proteasome dependent IRF3 degradation in rotavirus infected cells is dependent on the presence of rotavirus NSP1 and the integrity of the N-terminal zinc-binding domain.
17215277 ability of bICP0 to reduce IRF3 protein levels is important with respect to disarming the interferon response during productive infection
17182689 HIV-1 Vpr and Vif proteins cooperate with HIV-1 Vpu to induce IRF3 cleavage, although their individual effects are weaker than those of Vpu
17142768 Both the cytoplasmic and TLR3-mediated dsRNA recognition pathways converge upon NAP1 for the activation of the IRF-3 and IFN-beta promoter.
17126870 hypothesized that HSV-1 ICP0 recruits activated IRF-3 & CBP/p300 to nuclear structures, away from host chromatin; this leads to inactivation & accelerated degradation of IRF-3, resulting in reduced transcription of IFN-beta & inhibition of host response
17079482 Transduction of active forms of IRF-3 or IRF-7 differentially modulate the apoptotic and antitumor properties of primary macrophages.
16988763 IRF-3 is a key molecule controlling HCV replication through modulation of host interferon gene responses.
16984921 IPS-1, IRF3, and IFNbeta have critical roles in Legionella infection of lung epithelium
16940530 expression of the LCMV nucleoprotein (NP) is sufficient to inhibit both IFN production and nuclear translocation of IRF-3
16585524 HCV infection transiently induces RIG-I- and IPS-1-dependent IRF-3 activation
16537515 belongs to one signaling pathway that mediates induction of gene expression, which, in concert, mediates proliferative activity toward endothelial cells
16513254 IRF3 induces cell growth inhibition and cellular senescence through activation of p53 tumor suppressor
16501100 West Nile virus avoids IRF3 pathway through RIG-1 dependent and independent pathways early in infection when it is most sensitive to host cell defenses
16394098 The present study identified a specific interaction between IRF3 and chaperone heat-shock protein of 90 kDa (Hsp90).In addition, TBK1 is found to be a client protein of Hsp90 in vivo.
16199137 Expression of IKK-i can activate both NFkappaB and IRF3, leading to the production of several cytokines including interferon beta.
16182584 JEV and DEN-2 initiate the host innate immune response through a molecular mechanism involving RIG-I/IRF-3 and PI3K/NF-kappaB signaling pathways
15955070 ArgII gene is an early IRF-3-regulated gene, which participates in the interferon-independent antiviral response through polyamine production and induction of apoptosis.
15919920 activation inhibited by Rabies virus P protein
15767394 NF-kappaB and interferon regulatory factor, the two major transcription factors activated by virus infection, were essential for the induction of two sets of genes by Sendai virus
15452220 Cytomegalovirus pp65 prevents activation of IRF-3, a primary mediator of the type I interferon response.
15303122 Observational study of gene-disease association. (HuGE Navigator)
15220448 activated by West Nile Virus (WNV)infection. Irf-3 target genes function to constrain WNV infection and limit cell-to-cell virus spread.
15107417 IRF3 activities are essential for the initiation of transcription of the IFNbeta gene
14982987 double-stranded RNA-induced TLR3/TRIF-mediated NF-kappaB and IRF3 activation diverge at TRIF
14747536 enveloped particles from RNA and DNA viruses induce interferon-stimulated genes (ISGs) in the absence of IFN production and virus replication through activation of IRF3
14747533 herpes simplex virus ICP0 blocks interferon regulatory factor IRF3-mediated activation of interferon-stimulated genes; the RING finger domain of ICP0 is essential for this activity
14703513 Ser-386 is the target of the IRF-3 kinase and critical determinant for the activation of IRF-3
14557267 p65 promoted transactivation of gene expression by IRF-3; a dominant negative form of I kappa B kinase 2 and a mutant form of I kappa B, which acts as a super-repressor of NF-kappa B, blocked activation of the ISRE
14517278 LPS-TLR4 signaling to IRF-3/7 and NF-kappaB involves the toll adapters TRAM and TRIF.
12829839 Bunyamwera (BUN) NSs protein can delay cell death in the early stages of BUN infection by inhibiting IRF-3-mediated apoptosis.
12829834 In Ebola virus-infected cells, VP35 inhibits the induction of antiviral genes, including the IFN-beta gene, by blocking IRF-3 activation
12692549 IKKepsilon and TBK1 have a pivotal role in coordinating the activation of IRF3 and NF-kappaB in the innate immune response.
12582166 hIRF3 inhibited cell growth, blocked DNA synthesis, and induced apoptosis, while a dominant negative mutant transformed 3T3 cells, implying that IRF3 may function as a tumor suppressor and its dominant negative mutant may have a role in tumorigenesis.
12524442 Ser(396) within the C-terminal Ser/Thr cluster is targeted in vivo for phosphorylation following virus infection and plays an essential role in IRF-3 activation
12473110 IRF3 binds to p300/CBP and acts as a transcription factor
12354379 IRF3 mediates a TLR3/TLR4-specific antiviral gene program.
11972054 IRF-3-dependent, NFkappa B- and JNK-independent activation of the 561 and IFN-beta genes in response to double-stranded RNA
11940575 Direct involvement of CREB-binding protein/p300 in sequence-specific DNA binding of virus-activated interferon regulatory factor-3 holocomplex.
11907205 IRF-3 recognizes nucleocapsid structures during measles virus infections and triggers induction of interferon production
11884139 Preferential binding sites for interferon regulatory factors 3 and 7 involved in interferon-A gene transcription
11724783 human interferon regulatory factor-3 (IRF-3) gene promoter contains a functional SPH element that is bound by SBF/Staf in vitro and in transfected cells

AA Sequence

MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDK      1 - 70
PDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDIL     71 - 140
DELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFY    141 - 210
RGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQW    211 - 280
LWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGE    281 - 350
SWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMD    351 - 420
FQGPGES                                                                   421 - 427
//

Text Mined References (285)

PMID Year Title
26819312 2016 Suppression of Type I Interferon Production by Human T-Cell Leukemia Virus Type 1 Oncoprotein Tax through Inhibition of IRF3 Phosphorylation.
26811330 2016 Fas-Associated Factor 1 Negatively Regulates the Antiviral Immune Response by Inhibiting Translocation of Interferon Regulatory Factor 3 to the Nucleus.
26719279 2015 Membrane Perturbation-Associated Ca2+ Signaling and Incoming Genome Sensing Are Required for the Host Response to Low-Level Enveloped Virus Particle Entry.
26692175 2016 The tumor suppressor PTEN has a critical role in antiviral innate immunity.
26611114 2016 Inhibition of IRF3 expression reduces TGF-?1-induced proliferation of hepatic stellate cells.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26289783 2015 In silico mechanistic analysis of IRF3 inactivation and high-risk HPV E6 species-dependent drug response.
26216125 2015 Functional IRF3 deficiency in a patient with herpes simplex encephalitis.
26058929 2015 Decreased Expressions of STING but not IRF3 Molecules in Chronic HBV Infected Patients.
25893288 2015 The TEL-AML1 fusion protein of acute lymphoblastic leukemia modulates IRF3 activity during early B-cell differentiation.
25843157 2015 Common variants of IRF3 conferring risk of schizophrenia.
25811886 2015 Induction of interferon-stimulated genes by IRF3 promotes replication of Toxoplasma gondii.
25712217 2015 HSV-2 immediate-early protein US1 inhibits IFN-? production by suppressing association of IRF-3 with IFN-? promoter.
25636800 2015 Phosphorylation of innate immune adaptor proteins MAVS, STING, and TRIF induces IRF3 activation.
25609812 2015 Tom70 mediates Sendai virus-induced apoptosis on mitochondria.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25506707 2014 HSPD1 interacts with IRF3 to facilitate interferon-beta induction.
25481026 2014 The SARS coronavirus papain like protease can inhibit IRF3 at a post activation step that requires deubiquitination activity.
25444175 2015 TLR3 engagement induces IRF-3-dependent apoptosis in androgen-sensitive prostate cancer cells and inhibits tumour growth in vivo.
25352594 2014 HIV-1 Vpu accessory protein induces caspase-mediated cleavage of IRF3 transcription factor.
25232931 2014 Primate-specific miR-576-3p sets host defense signalling threshold.
25159465 2014 Identification of novel gene signatures in patients with atopic dermatitis complicated by eczema herpeticum.
25130328 2014 Interferon regulatory factor 3 as key element of the interferon signature in plasmacytoid dendritic cells from systemic lupus erythematosus patients: novel genetic associations in the Mexican mestizo population.
24879293 2014 Interferon regulatory factor 3 in adaptive immune responses.
24872591 2014 Porcine epidemic diarrhea virus nucleocapsid protein antagonizes beta interferon production by sequestering the interaction between IRF3 and TBK1.
24807717 2014 Novel roles of cytoplasmic ICP0: proteasome-independent functions of the RING finger are required to block interferon-stimulated gene production but not to promote viral replication.
24807708 2014 RIOK3 is an adaptor protein required for IRF3-mediated antiviral type I interferon production.
24800889 2014 Sustained activation of interferon regulatory factor 3 during infection by paramyxoviruses requires MDA5.
24726876 2014 Recruitment of phosphatase PP2A by RACK1 adaptor protein deactivates transcription factor IRF3 and limits type I interferon signaling.
24722640 2014 HSV-2 increases TLR4-dependent phosphorylated IRFs and IFN-? induction in cervical epithelial cells.
24535579 2014 Repression of interferon regulatory factor 3 by the Epstein-Barr virus immediate-early protein Rta is mediated through E2F1 in HeLa cells.
24531619 2014 Death-associated protein kinase 1 is an IRF3/7-interacting protein that is involved in the cellular antiviral immune response.
24385435 2014 Transcriptional regulation of IFN-? genes in hepatitis C virus-infected hepatocytes via IRF-3·IRF-7·NF-?B complex.
24335286 2014 Evasion of antiviral immunity through sequestering of TBK1/IKK?/IRF3 into viral inclusion bodies.
24275658 2014 Mitogen-activated protein kinase-mediated licensing of interferon regulatory factor 3/7 reinforces the cell response to virus.
24275652 2014 CD14 mediates Toll-like receptor 4 (TLR4) endocytosis and spleen tyrosine kinase (Syk) and interferon regulatory transcription factor 3 (IRF3) activation in epithelial cells and impairs neutrophil infiltration and Pseudomonas aeruginosa killing in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24257594 2014 Direct, interferon-independent activation of the CXCL10 promoter by NF-?B and interferon regulatory factor 3 during hepatitis C virus infection.
24049179 2013 Herpes simplex virus 1 serine/threonine kinase US3 hyperphosphorylates IRF3 and inhibits beta interferon production.
24036127 2013 PIAS1 negatively modulates virus triggered type I IFN signaling by blocking the DNA binding activity of IRF3.
23994473 2013 Extensive cooperation of immune master regulators IRF3 and NF?B in RNA Pol II recruitment and pause release in human innate antiviral transcription.
23824799 2013 Herpes simplex virus 1-encoded tegument protein VP16 abrogates the production of beta interferon (IFN) by inhibiting NF-?B activation and blocking IFN regulatory factor 3 to recruit its coactivator CBP.
23755934 2013 Japanese encephalitis virus non-coding RNA inhibits activation of interferon by blocking nuclear translocation of interferon regulatory factor 3.
23746807 2013 Structural insights into the functions of TBK1 in innate antimicrobial immunity.
23650567 2013 MDA5 plays a crucial role in enterovirus 71 RNA-mediated IRF3 activation.
23649622 2013 Mechanism of endogenous regulation of the type I interferon response by suppressor of I?B kinase epsilon (SIKE), a novel substrate of TANK-binding kinase 1 (TBK1).
23596302 2013 CDK9-dependent transcriptional elongation in the innate interferon-stimulated gene response to respiratory syncytial virus infection in airway epithelial cells.
23552418 2013 HIV-1 Vpu does not degrade interferon regulatory factor 3.
23542224 2013 A variant in IRF3 impacts on the clinical outcome of AML patients submitted to Allo-SCT.
23532851 2013 FoxO1 negatively regulates cellular antiviral response by promoting degradation of IRF3.
23512614 2013 Interferon regulatory factor 3 alters glioma inflammatory and invasive properties.
23478265 2013 Human DEAD box helicase 3 couples I?B kinase ? to interferon regulatory factor 3 activation.
23303668 2013 Chlamydia pneumoniae impairs the innate immune response in infected epithelial cells by targeting TRAF3.
23281696 2013 Protein extract of ultraviolet-irradiated human skin keratinocytes promote the expression of mitogen-activated protein kinases, nuclear factor-?B and interferon regulatory factor-3 in Langerhans cells via Toll-like receptor 2 and 4.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23154183 2013 Regulation of cooperative function of the Il12b enhancer and promoter by the interferon regulatory factors 3 and 5.
23122814 2012 Impairment of interferon regulatory factor-3 activation by hepatitis C virus core protein basic amino acid region 1.
23077293 2013 Role of interferon regulatory factor 3-mediated apoptosis in the establishment and maintenance of persistent infection by Sendai virus.
23027953 2012 Nuclear IFI16 induction of IRF-3 signaling during herpesviral infection and degradation of IFI16 by the viral ICP0 protein.
22908223 2012 Tetraspanin 6 (TSPAN6) negatively regulates retinoic acid-inducible gene I-like receptor-mediated immune signaling in a ubiquitination-dependent manner.
22906770 2012 Lipopolysaccharide potentiates polychlorinated biphenyl-induced disruption of the blood-brain barrier via TLR4/IRF-3 signaling.
22843696 2012 Opposite orientations of a transcription factor heterodimer bind DNA cooperatively with interaction partners but have different effects on interferon-? gene transcription.
22745372 2012 Human bocavirus NP1 inhibits IFN-? production by blocking association of IFN regulatory factor 3 with IFNB promoter.
22705311 2013 Two new monoclonal antibodies for biochemical and flow cytometric analyses of human interferon regulatory factor-3 activation, turnover, and depletion.
22593165 2012 Vpu mediates depletion of interferon regulatory factor 3 during HIV infection by a lysosome-dependent mechanism.
22479513 2012 Tyrosine phosphorylation of the E3 ubiquitin ligase TRIM21 positively regulates interaction with IRF3 and hence TRIM21 activity.
22394562 2012 STING specifies IRF3 phosphorylation by TBK1 in the cytosolic DNA signaling pathway.
22394560 2012 The STING in the tail for cytosolic DNA-dependent activation of IRF3.
22307793 2012 Characterization of a spliced variant of human IRF-3 promoter and its regulation by the transcription factor Sp1.
22294846 2012 No association between IRF3 polymorphism and susceptibility to hepatitis B virus infection in Chinese patients.
22208359 2011 Interferon regulatory factor 3 plays an anti-inflammatory role in microglia by activating the PI3K/Akt pathway.
22170100 2011 Interferon regulatory factor 3 inhibits astrocyte inflammatory gene expression through suppression of the proinflammatory miR-155 and miR-155*.
22158869 2012 Phospholipase C?-2 and intracellular calcium are required for lipopolysaccharide-induced Toll-like receptor 4 (TLR4) endocytosis and interferon regulatory factor 3 (IRF3) activation.
22127978 2012 Enhanced interferon regulatory factor 3 binding to the interleukin-23p19 promoter correlates with enhanced interleukin-23 expression in systemic lupus erythematosus.
22028379 2011 SENP2 negatively regulates cellular antiviral response by deSUMOylating IRF3 and conditioning it for ubiquitination and degradation.
22027828 2011 Galectin-9 protein expression in endothelial cells is positively regulated by histone deacetylase 3.
22000020 2011 Activation of STAT6 by STING is critical for antiviral innate immunity.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21935451 2011 Host genetic risk factors for West Nile virus infection and disease progression.
21931555 2011 Vaccinia virus protein C6 is a virulence factor that binds TBK-1 adaptor proteins and inhibits activation of IRF3 and IRF7.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21859832 2011 Interferon-signaling pathway: associations with colon and rectal cancer risk and subsequent survival.
21835786 2011 Varicella-zoster virus immediate-early protein ORF61 abrogates the IRF3-mediated innate immune response through degradation of activated IRF3.
21816816 2011 Caspase-8-mediated cleavage inhibits IRF-3 protein by facilitating its proteasome-mediated degradation.
21782231 2011 MAVS forms functional prion-like aggregates to activate and propagate antiviral innate immune response.
21768204 2012 Sindbis virus induced phosphorylation of IRF3 in human embryonic kidney cells is not dependent on mTOR.
21698224 2011 Induction of Noxa-mediated apoptosis by modified vaccinia virus Ankara depends on viral recognition by cytosolic helicases, leading to IRF-3/IFN-?-dependent induction of pro-apoptotic Noxa.
21632562 2011 A novel mechanism for the inhibition of interferon regulatory factor-3-dependent gene expression by human respiratory syncytial virus NS1 protein.
21497908 2011 Regulation of influenza A virus induced CXCL-10 gene expression requires PI3K/Akt pathway and IRF3 transcription factor.
21468605 Increased MAPK and NF-?B expression of Langerhans cells is dependent on TLR2 and TLR4, and increased IRF-3 expression is partially dependent on TLR4 following UV exposure.
21419663 2011 RIG-I RNA helicase activation of IRF3 transcription factor is negatively regulated by caspase-8-mediated cleavage of the RIP1 protein.
21347389 2011 The varicella-zoster virus ORF47 kinase interferes with host innate immune response by inhibiting the activation of IRF3.
21281747 2011 Identification of novel alternative splicing variants of interferon regulatory factor 3.
21248248 2011 Absence of MyD88 results in enhanced TLR3-dependent phosphorylation of IRF3 and increased IFN-? and RANTES production.
21245146 2011 Identification of the synthetic cannabinoid R(+)WIN55,212-2 as a novel regulator of IFN regulatory factor 3 activation and IFN-beta expression: relevance to therapeutic effects in models of multiple sclerosis.
21228327 2011 IRF8 and IRF3 cooperatively regulate rapid interferon-? induction in human blood monocytes.
21225257 2011 Direct repression of the human IRF-3 promoter by E2F1.
21200386 2011 Interferon regulatory factor 3-CL, an isoform of IRF3, antagonizes activity of IRF3.
21182093 2011 Novel splice variants of human IKK? negatively regulate IKK?-induced IRF3 and NF-kB activation.
21120614 2011 The characterization of two novel IRF-3 transcripts starting from intron 2 of the wild type of IRF-3.
21102435 2011 ZAPS is a potent stimulator of signaling mediated by the RNA helicase RIG-I during antiviral responses.
21084487 2011 Genetic dissection of interferon-antagonistic functions of rabies virus phosphoprotein: inhibition of interferon regulatory factor 3 activation is important for pathogenicity.
20980500 2011 Differential regulation of human papillomavirus type 8 by interferon regulatory factors 3 and 7.
20933442 2010 The Rab11a GTPase controls Toll-like receptor 4-induced activation of interferon regulatory factor-3 on phagosomes.
20886096 2010 Pathogen specific, IRF3-dependent signaling and innate resistance to human kidney infection.
20826620 2010 The cysteine protease domain of porcine reproductive and respiratory syndrome virus non-structural protein 2 antagonizes interferon regulatory factor 3 activation.
20711230 2010 Hepatitis B virus X protein suppresses virus-triggered IRF3 activation and IFN-beta induction by disrupting the VISA-associated complex.
20631144 2010 Varicella-zoster virus immediate-early protein 62 blocks interferon regulatory factor 3 (IRF3) phosphorylation at key serine residues: a novel mechanism of IRF3 inhibition among herpesviruses.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20604809 2010 Ser386 phosphorylation of transcription factor IRF-3 induces dimerization and association with CBP/p300 without overall conformational change.
20581830 2010 The transcription factor MafB antagonizes antiviral responses by blocking recruitment of coactivators to the transcription factor IRF3.
20511230 2010 Identification of a novel in vivo virus-targeted phosphorylation site in interferon regulatory factor-3 (IRF3).
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20501320 2010 Aberrant expression of interferon regulatory factor 3 in human lung cancer.
20485298 2010 IRF-3 partners Bax in a viral-induced dance macabre.
20483755 2010 Synoviocyte innate immune responses: II. Pivotal role of IFN regulatory factor 3.
20454685 2010 Cellular localization of the herpes simplex virus ICP0 protein dictates its ability to block IRF3-mediated innate immune responses.
20418377 2010 A molecular mechanism for Toll-IL-1 receptor domain-containing adaptor molecule-1-mediated IRF-3 activation.
20403326 2010 Reconstitution of the RIG-I pathway reveals a signaling role of unanchored polyubiquitin chains in innate immunity.
20381110 2010 Epstein-Barr virus BRLF1 inhibits transcription of IRF3 and IRF7 and suppresses induction of interferon-beta.
20360684 2010 Viral apoptosis is induced by IRF-3-mediated activation of Bax.
20351107 2010 Differential gene expression downstream of Toll-like receptors (TLRs): role of c-Src and activating transcription factor 3 (ATF3).
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20308324 2010 Positive regulation of interferon regulatory factor 3 activation by Herc5 via ISG15 modification.
20154210 2010 Essential role of mitochondrial antiviral signaling, IFN regulatory factor (IRF)3, and IRF7 in Chlamydophila pneumoniae-mediated IFN-beta response and control of bacterial replication in human endothelial cells.
20049431 2010 Regulation of immunity and oncogenesis by the IRF transcription factor family.
20048166 2010 Kaposi sarcoma-associated herpesvirus latency-associated nuclear antigen inhibits interferon (IFN) beta expression by competing with IFN regulatory factor-3 for binding to IFNB promoter.
20048147 2010 Viral induction of the zinc finger antiviral protein is IRF3-dependent but NF-kappaB-independent.
19956647 2009 Expression of an IKKgamma splice variant determines IRF3 and canonical NF-kappaB pathway utilization in ssRNA virus infection.
19955181 2010 Human T cell lymphotropic virus 1 manipulates interferon regulatory signals by controlling the TAK1-IRF3 and IRF4 pathways.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19890046 2009 Role of double-stranded RNA pattern recognition receptors in rhinovirus-induced airway epithelial cell responses.
19858727 2010 Disease progression from chronic hepatitis C to cirrhosis and hepatocellular carcinoma is associated with repression of interferon regulatory factor-1.
19854139 2009 Key role of Ubc5 and lysine-63 polyubiquitination in viral activation of IRF3.
19826915 2010 Characterization of the human IRF-3 promoter and its regulation by the transcription factor E2F1.
19710021 2009 RNA-specific adenosine deaminase ADAR1 suppresses measles virus-induced apoptosis and activation of protein kinase PKR.
19706707 2009 Human immunodeficiency virus type 1 mediates global disruption of innate antiviral signaling and immune defenses within infected cells.
19701189 2009 Activation of innate immune antiviral responses by Nod2.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19646728 2009 TLR3 and TLR4 are innate antiviral immune receptors in human microglia: role of IRF3 in modulating antiviral and inflammatory response in the CNS.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19553679 2009 Identification of caspase-mediated decay of interferon regulatory factor-3, exploited by a Kaposi sarcoma-associated herpesvirus immunoregulatory protein.
19515829 2009 Infection with herpes simplex type 1-based amplicon vectors results in an IRF3/7-dependent, TLR-independent activation of the innate antiviral response in primary human fibroblasts.
19454348 2009 Influenza A virus NS1 targets the ubiquitin ligase TRIM25 to evade recognition by the host viral RNA sensor RIG-I.
19445677 2009 The interaction between the measles virus nucleoprotein and the Interferon Regulator Factor 3 relies on a specific cellular environment.
19434718 2009 Variants in interferon-alpha pathway genes and response to pegylated interferon-Alpha2a plus ribavirin for treatment of chronic hepatitis C virus infection in the hepatitis C antiviral long-term treatment against cirrhosis trial.
19426920 2009 Expression of interferon regulatory factor 1, 3, and 7 in primary Sjögren syndrome.
19380831 2009 The major outer membrane protein of a periodontopathogen induces IFN-beta and IFN-stimulated genes in monocytes via lipid raft and TANK-binding kinase 1/IFN regulatory factor-3.
19349300 2009 Differential regulation of human interferon A gene expression by interferon regulatory factors 3 and 7.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19239434 2009 Role of mitogen-activated protein kinases, nuclear factor-kappaB, and interferon regulatory factor 3 in Toll-like receptor 4-mediated activation of HIV long terminal repeat.
19213861 2009 No evidence for genetic association of interferon regulatory factor 3 in systemic lupus erythematosus.
19211751 2009 Differential modification of interferon regulatory factor 3 following virus particle entry.
19201840 2009 Carbon monoxide inhibits TLR-induced dendritic cell immunogenicity.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19153595 2009 The TAK1-JNK cascade is required for IRF3 function in the innate immune response.
19153231 2009 Ebola virus protein VP35 impairs the function of interferon regulatory factor-activating kinases IKKepsilon and TBK-1.
19152337 2009 Transcriptional re-programming of primary macrophages reveals distinct apoptotic and anti-tumoral functions of IRF-3 and IRF-7.
19124752 2009 Induction of proinflammatory cytokines in primary human macrophages by influenza A virus (H5N1) is selectively regulated by IFN regulatory factor 3 and p38 MAPK.
19038458 2009 Characterization of the interferon regulatory factor 3-mediated antiviral response in a cell line deficient for IFN production.
19028691 2009 The RNA-activated protein kinase enhances the induction of interferon-beta and apoptosis mediated by cytoplasmic RNA sensors.
19017982 2008 A novel IFN regulatory factor 3-dependent pathway activated by trypanosomes triggers IFN-beta in macrophages and fibroblasts.
19012493 2009 Common variants in immune and DNA repair genes and risk for human papillomavirus persistence and progression to cervical cancer.
18927075 2008 Induction of protein kinase PKR-dependent activation of interferon regulatory factor 3 by vaccinia virus occurs through adapter IPS-1 signaling.
18818105 2008 The adaptor protein MITA links virus-sensing receptors to IRF3 transcription factor activation.
18781139 2008 Inhibition of the IFN-beta response in hepatocellular carcinoma by alternative spliced isoform of IFN regulatory factor-3.
18713996 2008 Synoviocyte innate immune responses: I. Differential regulation of interferon responses and the JNK pathway by MAPK kinases.
18711448 2008 Negative feedback regulation of cellular antiviral signaling by RBCK1-mediated degradation of IRF3.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18641315 2008 The E3 ubiquitin ligase Ro52 negatively regulates IFN-beta production post-pathogen recognition by polyubiquitin-mediated degradation of IRF3.
18635538 2008 Virus infection triggers SUMOylation of IRF3 and IRF7, leading to the negative regulation of type I interferon gene expression.
18583960 2008 The DEAD-box helicase DDX3X is a critical component of the TANK-binding kinase 1-dependent innate immune response.
18579584 2008 STAT-1- and IRF-3-dependent pathways are not essential for repression of ICP0-null mutant herpes simplex virus type 1 in human fibroblasts.
18539711 2008 Promoter polymorphisms in the IRF3 gene confer protection against systemic lupus erythematosus.
18450748 2008 Homo-oligomerization is essential for Toll/interleukin-1 receptor domain-containing adaptor molecule-1-mediated NF-kappaB and interferon regulatory factor-3 activation.
18440553 2008 Contribution of Ser386 and Ser396 to activation of interferon regulatory factor 3.
18362887 2008 Epstein-Barr virus-encoded small RNA induces IL-10 through RIG-I-mediated IRF-3 signaling.
18309294 2008 S-glutathionylation of IRF3 regulates IRF3-CBP interaction and activation of the IFN beta pathway.
18272581 2008 Phosphorylation of IRF-3 on Ser 339 generates a hyperactive form of IRF-3 through regulation of dimerization and CBP association.
18272195 2008 Attenuation of the type I interferon response in cells infected with human rhinovirus.
18252870 2008 poly(I:C) and LPS induce distinct IRF3 and NF-kappaB signaling during type-I IFN and TNF responses in human macrophages.
18216110 2008 IRF-3 activation by Sendai virus infection is required for cellular apoptosis and avoidance of persistence.
18203148 2008 Interferon regulatory factor-3 activation, hepatic interferon-stimulated gene expression, and immune cell infiltration in hepatitis C virus patients.
18082865 2008 HIV-1 accessory proteins VPR and Vif modulate antiviral response by targeting IRF-3 for degradation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17761676 2007 Regulation of IRF-3-dependent innate immunity by the papain-like protease domain of the severe acute respiratory syndrome coronavirus.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17652396 2007 Binding of Kaposi's sarcoma-associated herpesvirus K-bZIP to interferon-responsive factor 3 elements modulates antiviral gene expression.
17641046 2007 Early innate immune responses to Sin Nombre hantavirus occur independently of IFN regulatory factor 3, characterized pattern recognition receptors, and viral entry.
17626075 2007 Astrocyte indoleamine 2,3-dioxygenase is induced by the TLR3 ligand poly(I:C): mechanism of induction and role in antiviral response.
17608743 2007 YopJ targets TRAF proteins to inhibit TLR-mediated NF-kappaB, MAPK and IRF3 signal transduction.
17599067 2007 Involvement of the ubiquitin-like domain of TBK1/IKK-i kinases in regulation of IFN-inducible genes.
17560375 2007 Structure of IRF-3 bound to the PRDIII-I regulatory element of the human interferon-beta enhancer.
17540767 2007 Retinoic acid-inducible gene-I and interferon-beta promoter stimulator-1 augment proapoptotic responses following mammalian reovirus infection via interferon regulatory factor-3.
17526488 2007 Interferon regulatory factor 3 is regulated by a dual phosphorylation-dependent switch.
17449641 2007 Double-stranded RNA induces galectin-9 in vascular endothelial cells: involvement of TLR3, PI3K, and IRF3 pathway.
17393359 Differential expression patterns of IRF3 and IRF7 in pediatric lymphoid disorders.
17328045 2007 Antiviral gene expression in rheumatoid arthritis: role of IKKepsilon and interferon regulatory factor 3.
17251580 2007 Zinc-binding domain of rotavirus NSP1 is required for proteasome-dependent degradation of IRF3 and autoregulatory NSP1 stability.
17215277 2007 The infected cell protein 0 encoded by bovine herpesvirus 1 (bICP0) induces degradation of interferon response factor 3 and, consequently, inhibits beta interferon promoter activity.
17142768 2006 NAK-associated protein 1 participates in both the TLR3 and the cytoplasmic pathways in type I IFN induction.
17126870 2007 Recruitment of activated IRF-3 and CBP/p300 to herpes simplex virus ICP0 nuclear foci: Potential role in blocking IFN-beta induction.
17121613 2006 Mapping of nine porcine interferon regulatory factor genes.
17079482 2006 Distinct roles for IFN regulatory factor (IRF)-3 and IRF-7 in the activation of antitumor properties of human macrophages.
17079289 2007 Inhibition of retinoic acid-inducible gene I-mediated induction of beta interferon by the NS1 protein of influenza A virus.
16988763 2006 Negative regulation of intracellular hepatitis C virus replication by interferon regulatory factor 3.
16984921 2006 Legionella pneumophila induces IFNbeta in lung epithelial cells via IPS-1 and IRF3, which also control bacterial replication.
16979567 2006 Type I interferon [corrected] gene induction by the interferon regulatory factor family of transcription factors.
16940530 2006 Inhibition of the type I interferon response by the nucleoprotein of the prototypic arenavirus lymphocytic choriomeningitis virus.
16846591 2006 Distinct functions of IRF-3 and IRF-7 in IFN-alpha gene regulation and control of anti-tumor activity in primary macrophages.
16585524 2006 Viral and therapeutic control of IFN-beta promoter stimulator 1 during hepatitis C virus infection.
16537515 2006 Identification of proangiogenic genes and pathways by high-throughput functional genomics: TBK1 and the IRF3 pathway.
16513254 2006 Interferon regulatory factor 3 activates p53-dependent cell growth inhibition.
16501100 2006 West Nile virus evades activation of interferon regulatory factor 3 through RIG-I-dependent and -independent pathways without antagonizing host defense signaling.
16394098 2006 Hsp90 regulates activation of interferon regulatory factor 3 and TBK-1 stabilization in Sendai virus-infected cells.
16362036 2006 The GRIP1:IRF3 interaction as a target for glucocorticoid receptor-mediated immunosuppression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16301520 2005 Hepatitis C virus protease NS3/4A cleaves mitochondrial antiviral signaling protein off the mitochondria to evade innate immunity.
16281057 2005 SIKE is an IKK epsilon/TBK1-associated suppressor of TLR3- and virus-triggered IRF-3 activation pathways.
16199137 2006 IKK-i signals through IRF3 and NFkappaB to mediate the production of inflammatory cytokines.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16182584 2006 Flavivirus induces interferon-beta gene expression through a pathway involving RIG-I-dependent IRF-3 and PI3K-dependent NF-kappaB activation.
16154084 2005 Crystal structure of IRF-3 in complex with CBP.
16153868 2005 VISA is an adapter protein required for virus-triggered IFN-beta signaling.
15955070 2005 Regulation of arginase II by interferon regulatory factor 3 and the involvement of polyamines in the antiviral response.
15919920 2005 Identification of the rabies virus alpha/beta interferon antagonist: phosphoprotein P interferes with phosphorylation of interferon regulatory factor 3.
15841462 2005 Interaction between the HCV NS3 protein and the host TBK1 protein leads to inhibition of cellular antiviral responses.
15767394 2005 Analysis of genes induced by Sendai virus infection of mutant cell lines reveals essential roles of interferon regulatory factor 3, NF-kappaB, and interferon but not toll-like receptor 3.
15764595 2005 Role of cyclophilin B in activation of interferon regulatory factor-3.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15695821 2005 The interferon regulatory factor, IRF5, is a central mediator of toll-like receptor 7 signaling.
15510218 2004 Crystal structure of ATF-2/c-Jun and IRF-3 bound to the interferon-beta enhancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15452220 2004 Major human cytomegalovirus structural protein pp65 (ppUL83) prevents interferon response factor 3 activation in the interferon response.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15303122 2004 [Relationship between polymorphism of IRF-3 gene codon 427 and esophageal cancer in Anyang population of China].
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15251447 2004 PIASy represses TRIF-induced ISRE and NF-kappaB activation but not apoptosis.
15220448 2004 The host response to West Nile Virus infection limits viral spread through the activation of the interferon regulatory factor 3 pathway.
15107417 2004 Oxidized low density lipoprotein blocks lipopolysaccharide-induced interferon beta synthesis in human macrophages by interfering with IRF3 activation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14982987 2004 Toll-like receptor 3-mediated activation of NF-kappaB and IRF3 diverges at Toll-IL-1 receptor domain-containing adapter inducing IFN-beta.
14747536 2004 Innate cellular response to virus particle entry requires IRF3 but not virus replication.
14747533 2004 The herpes simplex virus ICP0 RING finger domain inhibits IRF3- and IRF7-mediated activation of interferon-stimulated genes.
14739303 2004 Mechanisms of the TRIF-induced interferon-stimulated response element and NF-kappaB activation and apoptosis pathways.
14703513 2004 Identification of Ser-386 of interferon regulatory factor 3 as critical target for inducible phosphorylation that determines activation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14557267 2003 Interferon regulatory factor-3-mediated activation of the interferon-sensitive response element by Toll-like receptor (TLR) 4 but not TLR3 requires the p65 subunit of NF-kappa.
14555996 2003 Crystal structure of IRF-3 reveals mechanism of autoinhibition and virus-induced phosphoactivation.
14555995 2003 X-ray crystal structure of IRF-3 and its functional implications.
14517278 2003 LPS-TLR4 signaling to IRF-3/7 and NF-kappaB involves the toll adapters TRAM and TRIF.
12883638 2003 Identification of interaction between PAI-2 and IRF-3.
12829839 2003 Bunyamwera virus nonstructural protein NSs counteracts interferon regulatory factor 3-mediated induction of early cell death.
12829834 2003 The Ebola virus VP35 protein inhibits activation of interferon regulatory factor 3.
12702806 2003 Triggering the interferon antiviral response through an IKK-related pathway.
12692549 2003 IKKepsilon and TBK1 are essential components of the IRF3 signaling pathway.
12604599 2003 Interferon regulatory factor-7 synergizes with other transcription factors through multiple interactions with p300/CBP coactivators.
12582166 2003 Oncogenic potential of a dominant negative mutant of interferon regulatory factor 3.
12524442 2003 Identification of the minimal phosphoacceptor site required for in vivo activation of interferon regulatory factor 3 in response to virus and double-stranded RNA.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473110 2002 Transcriptional activity of interferon regulatory factor (IRF)-3 depends on multiple protein-protein interactions.
12471095 2002 Cutting edge: a novel Toll/IL-1 receptor domain-containing adapter that preferentially activates the IFN-beta promoter in the Toll-like receptor signaling.
12354379 2002 IRF3 mediates a TLR3/TLR4-specific antiviral gene program.
12186937 2002 Interferon regulatory factor 3 is a cellular partner of rotavirus NSP1.
12062447 2002 Involvement of TIRAP/MAL in signaling for the activation of interferon regulatory factor 3 by lipopolysaccharide.
11972054 2002 IRF-3-dependent, NFkappa B- and JNK-independent activation of the 561 and IFN-beta genes in response to double-stranded RNA.
11940575 2002 Direct involvement of CREB-binding protein/p300 in sequence-specific DNA binding of virus-activated interferon regulatory factor-3 holocomplex.
11884139 2002 Preferential binding sites for interferon regulatory factors 3 and 7 involved in interferon-A gene transcription.
11846977 2002 Control of IRF-3 activation by phosphorylation.
11724783 2002 The Small RNA gene activator protein, SphI postoctamer homology-binding factor/selenocysteine tRNA gene transcription activating factor, stimulates transcription of the human interferon regulatory factor-3 gene.
11314014 2001 HHV-8 encoded vIRF-1 represses the interferon antiviral response by blocking IRF-3 recruitment of the CBP/p300 coactivators.
11303025 2001 Virus-specific activation of a novel interferon regulatory factor, IRF-5, results in the induction of distinct interferon alpha genes.
11162841 2001 Analysis of functional domains of interferon regulatory factor 7 and its association with IRF-3.
11124948 2001 IRF3 and IRF7 phosphorylation in virus-infected cells does not require double-stranded RNA-dependent protein kinase R or Ikappa B kinase but is blocked by Vaccinia virus E3L protein.
11035028 2001 Identification of distinct signaling pathways leading to the phosphorylation of interferon regulatory factor 3.
10920266 2000 Analyses of virus-induced homomeric and heteromeric protein associations between IRF-3 and coactivator CBP/p300.
10805757 2000 Regulated nuclear-cytoplasmic localization of interferon regulatory factor 3, a subunit of double-stranded RNA-activated factor 1.
10521456 1999 Activation of interferon regulatory factor 3 in response to DNA-damaging agents.
10492399 1999 Cloning and functional analysis of the human IRF-3 promoter.
9865487 Role of the interferon regulatory factors (IRFs) in virus-mediated signaling and regulation of cell growth.
9803267 1998 Mapping of human interferon regulatory factor 3 (IRF3) to chromosome 19q13.3-13.4 by an intragenic polymorphic marker.
9566918 1998 Virus-dependent phosphorylation of the IRF-3 transcription factor regulates nuclear translocation, transactivation potential, and proteasome-mediated degradation.
9488451 1998 Interferon regulatory factor 3 and CREB-binding protein/p300 are subunits of double-stranded RNA-activated transcription factor DRAF1.
9463386 1998 Direct triggering of the type I interferon system by virus infection: activation of a transcription factor complex containing IRF-3 and CBP/p300.
8524823 1995 Identification of a member of the interferon regulatory factor family that binds to the interferon-stimulated response element and activates expression of interferon-induced genes.