Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.15
PubTator Score 8.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma 1.100 1.8e-02
ependymoma 1.400 9.3e-03
oligodendroglioma 1.400 3.8e-03
osteosarcoma -1.275 1.8e-04
glioblastoma 1.500 7.1e-05
group 3 medulloblastoma 1.900 4.8e-04
atypical teratoid / rhabdoid tumor 1.600 3.5e-07
medulloblastoma, large-cell 2.300 1.2e-06
primitive neuroectodermal tumor 1.300 5.8e-03
juvenile dermatomyositis 1.214 1.7e-07
primary pancreatic ductal adenocarcinoma 1.783 8.7e-03
breast carcinoma 1.300 1.3e-02
adult high grade glioma 1.500 2.4e-03
psoriasis -1.300 4.7e-16
Alzheimer's disease 1.200 3.3e-02
Pick disease 2.100 9.2e-07
ovarian cancer 1.500 1.2e-03
pancreatic cancer 1.800 7.9e-03

Gene RIF (9)

PMID Text
26593974 ETO2 and IRF2BP2 interacting with the NCOR1/SMRT co-repressor complex, suppresses the expression of erythroid genes until erythroid differentiation.
26195219 A deletion variant that lowers IRF2BP2 expression predisposes to coronary artery disease in humans.
23185413 analysis of an IRF2BP2-CDX1 fusion gene brought about by translocation t(1;5)(q42;q32) in mesenchymal chondrosarcoma
21887377 Nuclear localization of IRF2BP2 depends on phosphorylation near a conserved NLS. Changes in phosphorylation status likely control nucleocytoplasmic localization of IRF2BP2 during muscle differentiation.
21576369 Data demonstrate that IRF-2BP2 is a negative regulator of the NFAT1 transcription factor and suggest that NFAT1 repression occurs at the transcriptional level.
20702774 IRF2BP2 is a novel ischemia-induced coactivator of VEGFA expression that may contribute to revascularization of ischemic cardiac and skeletal muscles.
20702774 IRF2BP2 works with TEAD transcription factors to upregulate the expression of VEGFA in skeletal and cardiac muscle. IRF2BP2 protein levels are increased in response to tissue ischemia.
19190336 results indicate that DIF-1 plays a key role in breast cancer cell survival
12799427 Identification of IRF-2 binding protein 1 and IRF-2 binding protein 2 as co-repressor molecules for interferon regulatory factor-2.

AA Sequence

MAAAVAVAAASRRQSCYLCDLPRMPWAMIWDFTEPVCRGCVNYEGADRVEFVIETARQLKRAHGCFPEGR      1 - 70
SPPGAAASAAAKPPPLSAKDILLQQQQQLGHGGPEAAPRAPQALERYPLAAAAERPPRLGSDFGSSRPAA     71 - 140
SLAQPPTPQPPPVNGILVPNGFSKLEEPPELNRQSPNPRRGHAVPPTLVPLMNGSATPLPTALGLGGRAA    141 - 210
ASLAAVSGTAAASLGSAQPTDLGAHKRPASVSSSAAVEHEQREAAAKEKQPPPPAHRGPADSLSTAAGAA    211 - 280
ELSAEGAGKSRGSGEQDWVNRPKTVRDTLLALHQHGHSGPFESKFKKEPALTAGRLLGFEANGANGSKAV    281 - 350
ARTARKRKPSPEPEGEVGPPKINGEAQPWLSTSTEGLKIPMTPTSSFVSPPPPTASPHSNRTTPPEAAQN    351 - 420
GQSPMAALILVADNAGGSHASKDANQVHSTTRRNSNSPPSPSSMNQRRLGPREVGGQGAGNTGGLEPVHP    421 - 490
ASLPDSSLATSAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSRQSIKQQGASGEVYCPSGEKCPLVGS    491 - 560
NVPWAFMQGEIATILAGDVKVKKERDS                                               561 - 587
//

Text Mined References (32)

PMID Year Title
26593974 2015 Control of developmentally primed erythroid genes by combinatorial co-repressor actions.
26195219 2015 IRF2BP2 Reduces Macrophage Inflammation and Susceptibility to Atherosclerosis.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23185413 2012 Whole-transcriptome sequencing identifies novel IRF2BP2-CDX1 fusion gene brought about by translocation t(1;5)(q42;q32) in mesenchymal chondrosarcoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22247754 2012 Genome-wide association of implantable cardioverter-defibrillator activation with life-threatening arrhythmias.
21887377 2011 Identification of a phosphorylation-dependent nuclear localization motif in interferon regulatory factor 2 binding protein 2.
21576369 2011 Interferon regulatory factor 2 binding protein 2 is a new NFAT1 partner and represses its transcriptional activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20702774 2010 IRF2BP2 is a skeletal and cardiac muscle-enriched ischemia-inducible activator of VEGFA expression.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19190336 2009 Identification of a novel pathway that selectively modulates apoptosis of breast cancer cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17121613 2006 Mapping of nine porcine interferon regulatory factor genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12799427 2003 Identification of novel co-repressor molecules for Interferon Regulatory Factor-2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.