Property Summary

NCBI Gene PubMed Count 106
PubMed Score 182.38
PubTator Score 133.07

Knowledge Summary

Patent (19,575)

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.200 4.3e-06

Protein-protein Interaction (6)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (85)

PMID Text
26698383 Siblings with compound heterozygosity for two mutations: a frameshift mutation at one allele (c.1146delT (p.G383fs)), and an in-frame duplication variant at the other (c.255_260dup6 (p.D86_L87dup)) leading to fatal pneumococcal meningitis is described.
26472314 missense mutation results in immunological deficiency phenotype
26075815 This is the first study to show an association between single nucleotide polymorphisms in IRAK1, IRAK4 and MyD88, and the presence of severe invasive pneumococcal disease.
25922567 Src, Syk, IRAK1, and IRAK4 have roles in anti-inflammatory responses mediated by dietary flavonoid Kaempferol
25886387 findings suggest that rare, functional variants in MYD88, IRAK4 or IKBKG do not significantly contribute to IPD susceptibility in adults at the population level
25479567 Studies indicate that interleukin-1 receptor-associated kinase 4 protein (IRAK4), a serine/threonine kinase, plays a key role in both inflammation and oncology diseases.
25344726 delineation of the latter responses identified a narrow repertoire of transcriptional programs affected by loss of MyD88 function or IRAK4 function
25320238 by bolstering the IgM(+)IgD(+)CD27(+) B-cell subset, IRAK-4 and MyD88 promote optimal T-independent IgM antibody responses against bacteria in humans.
25201411 Data show that dimerization is crucial for IRAK4 autophosphorylation in vitro and ligand dependent signaling in cells.
24690905 High mRNA levels of IRAK1 and IRAK4 correlated with VKH disease activity.
24567333 IRAK4 is regulated by Interleukin 1/Toll-like receptor-induced autophosphorylation
24316379 these studies suggest that not only the loss of protein expression but also the defect of Myddosome formation couldcause IRAK4 and MyD88 deficiency syndromes.
23595970 Studied the TMZ-induced changes in the proteome of the glioma-derived cell line (U251) by 2D DIGE. We found 95 protein spots to be significantly altered in their expression after TMZ treatment.
23591012 Dominant negative mutants of IRAK4 and GAK show strong apoptotic effects in A498 cells under anoxia.
23519847 these data highlight an unexpected role of IRAK4, Akt, and mTOR in the regulation of tolerance in human monocytes
23264652 During bacterial infection, PGN-mediated TLR2 signaling induces miR-132/-212 to downregulate IRAK4.
23255009 Experimental and natural infections in MyD88- and IRAK-4-deficient mice and humans.
23100432 This study demonstrated that IRAK4 activation acts normally to regulate microglial activation status and influence amyloid homeostasis in the brain.
23041547 Evaluates the effects of stimulating or inhibiting the TLR/IL-1 receptor-associated kinases IRAK-1 and IRAK-4 in melanoma cells where their functions are largely unexplored.
23027530 We report the association of two tag SNPS (i.e., rs1461567 and rs4251513) distributed in the IRAK4 gene with brain and ocular alterations in congenital toxoplasmosis.
23002119 IgM(+)IgD(+)CD27(+) but not switched B cells were strongly reduced in MYD88-, IRAK-4-, and TIRAP-deficient patients, but not UNC-93B-deficient patients.
22932140 The IRAK4 SNPs rs3794262 and rs4251481 were associated with allergy to dust mites, but not other types of allergic rhinitis.
22606974 The results indicated that IRAK-4 gene silencing in MG63 cells inhibited cell proliferation and function and increase apoptosis, which may be related to the decreased Bcl-2/Bax ratio and inhibition of the protein expression.
22059479 investigation of signaling components that induce activation of post-transcriptional mechanism for IkappaB-zeta induction/activation: Activation of IRAK1 or IRAK4, but not TRAF6, is sufficient.
21738793 The results demonstrated a gender- and allergen-dependant association pattern between polymorphisms in IRAK-4 and AR in Chinese population.
21576904 genetic polymorphism is associated with increased prevalence of gram-positive infection and decreased response to toll-like receptor ligands
21220427 LPS-induced activation of IRAK4 and TAK1, K63-linked polyubiquitination of IRAK1 and TRAF6, and disrupted IRAK1-TRAF6 and IRAK1-IKKgamma assembly associated with increased A20 expression
21205819 evidence that the structure-function similarities that we have identified between LYK3 and IRAK-4 may be more widely applicable to plant RLKs in general.
21166654 These results indicate that IL-1beta-induced IL-6 production in A549 cells is mediated by both PI3K and IRAK4 and suggest that involvement of PI3K in the IL-1-induced IL-6 production is cell type specific.
21160042 Although IRAK4 kinase activity is essential for human plasmacytoid dendritic cell activation, it is dispensable in B, T, dendritic, and monocytic cells, which is in contrast with an essential active kinase role in comparable mouse cell types.
20966070 Two variants found in the MyD88 death domain, S34Y and R98C, showed severely reduced NF-kappaB activation due to reduced homo-oligomerization and IRAK4 interaction
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20621347 IRAK-4-deficient patients have defects in T-cell activation.
20588308 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485341 the crystal structure of the MyD88-IRAK4-IRAK2 death domain (DD) complex, which surprisingly reveals a left-handed helical oligomer that consists of 6 MyD88, 4 IRAK4 and 4 IRAK2 DDs
20448286 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20400509 Mal is a substrate for IRAK1 and IRAK4 with phosphorylation promoting ubiquitination and degradation of Mal, which may serve to negatively regulate signaling by TLR2 and TLR4
20105294 Data demonstrate that the vast majority of LPS-responsive genes in IRAK4-deficient monocytes were greatly suppressed, an observation that is consistent with the described role for IRAK4 as an essential component of TLR4 signalling.
20104875 A detailed kinetic characterization of the phosphoryl transfer activity of IRAK-4 toward a peptide substrate derived from the activation loop of IRAK-1 is described. IRAK-4 obeys a sequential kinetic pathway.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898481 Observational study of gene-disease association. (HuGE Navigator)
19703016 IRAK-4, which is essential for virtually all TLR signalling, was suppressed, whereas the precursor for the antibiotic peptide Dermcidin was up-regulated in HIV-infected cells.
19592493 analysis of an oligomeric signaling platform formed by the Toll-like receptor signal transducers MyD88 and IRAK-4
19505919 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19254290 These results demonstrate a clear association between polymorphisms in the IRAK4 gene and serum IgE levels in patients with chronic rhinosinusitis and asthma
19254290 Observational study of gene-disease association. (HuGE Navigator)
19181383 In human cells the non-kinase functions of IRAK-4 are essential, whereas the kinase activity of IRAK-4 appears redundant with that of IRAK-1.
19120481 patients with congenital deficiencies show enhanced susceptibility to pyogenic bacteria such as Staphylococcus or Pneumococcus
19074885 Observational study of gene-disease association. (HuGE Navigator)
19006693 IRAK-4-, MyD88-, and UNC-93B-deficient patients did not display autoreactive antibodies in their serum or develop autoimmune diseases, suggesting that IRAK-4, MyD88, and UNC-93B pathway blockade may thwart autoimmunity in humans.
18987746 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18503546 These results demonstrate that downregulation of IRAK-4 requires activation of the MyD88-dependent pathway and that the death domains of both MyD88 and IRAK-4 are important for this downregulation.
18174872 Two cases of IRAK-4 deficiency that presented with unusual S. aureus infections that were not accompanied by the expected constitutional symptoms or hematologic and acute phase responses are reported.
18079163 These results suggested that the expression of IRAK-4 alone is sufficient to cause the degradation of IRAK-1; the autophosphorylation of IRAK-1 is not necessary to terminate the TLR-induced activation of NF-kappaB.
17997719 Pellino isoforms may be the E3 ubiquitin ligases that mediate the IL-1-stimulated formation of K63-pUb-IRAK1 in cells, which may contribute to activation of IKKbeta and transcription factor NF-kappaB, as well as signalling pathways dependent on IRAK1/4
17917042 Inherited human IRAK-4 deficiency, a recently described primary immunodeficiency leading to recurrent, invasive, pyogenic bacteria infection, and invasive pneumococcal disease in particular, is reviewed.
17893200 IRAK-4-dependent human Toll-like receptors appear to play a redundant role in protective immunity to most infections, at most limited to childhood immunity to some pyogenic bacteria
17878374 suggest the existence of an IRAK-4-independent TLR9-induced transduction pathway leading to PI3K activation
17703412 Observational study of gene-disease association. (HuGE Navigator)
17675297 kinase-inactive IRAK proteins can associate with Pellino proteins, thus excluding the possibility that their inability to regulate Pellino degradation is due to lack of association with the Pellino proteins
17548806 ST2825 interfered with recruitment of IRAK1 and IRAK4 by MyD88, causing inhibition of IL-1beta-mediated activation of NF-kappaB transcriptional activity.
17507369 IL-1RAcP, MyD88, and IRAK-4 are the stable components of the endogenous type I interleukin-1 (IL-1) receptor signaling complex
17217339 We conclude that IRAK-4 phosphorylates p47phox and regulates NADPH oxidase activation after LPS stimulation.
17161373 crystallographic analysis of IRAK-4 kinase in complex with inhibitors
17141195 The present data indicate that the kinase activity of IRAK-4 is dependent on the autophosphorylations at T342, T345, and S346 in the activation loop.
17046325 Although each system seems to possess distinct activation mechanisms, interleukin-1 receptor-associated kinase (IRAK)-4 is essential for NF-kappaB activation in Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways.
16907704 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16537705 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16286015 The TLR-7-, TLR-8-, and TLR-9-dependent induction of IFN-alpha/beta and -lambda is strictly IRAK-4 dependent and paradoxically redundant for protective immunity to most viruses in humans
15905496 This study demonstrates several mechanisms by which overexpression of truncated, kinase-deficient forms of IRAK-4 in a patient with recurrent bacterial infections may disrupt signaling induced by lipopolysaccharide or IL-1.
15825022 Systemic shigellosis in a person with a primary immunodeficiency, expanding the spectrum of infections associated with IRAK-4 deficiency is reported.
15292196 IRAK-4 is an integral part of the IL-1R signaling cascade and is capable of transmitting signals both dependent on and independent of its kinase activity
15084582 IRAK4 is required for the efficient recruitment of IRAK to the IL-1 receptor complex
12925671 Results suggest that IRAK-4 is pivotal in the development of a normal inflammatory response initiated by bacterial or nonbacterial insults.
12860405 Pellino2 interacts with kinase-active as well as kinase-inactive IRAK1 and IRAK4
12637671 described 3 children with inherited IRAK-4 deficiency who developed pyogenic bacterial infections; findings suggest the TIR-IRAK signaling pathway is crucial for protective immunity against specific bacteria but redundant against most other microorganisms
12496252 Pellino 1 is required for interleukin-1-mediated signaling through its interaction with the interleukin-1 receptor-associated kinase 4-IRAK-tumor necrosis factor receptor-associated factor 6 complex
12297423 Gene targeting studies show that IRAK-4 has an essential role in mediating signals initiated by IL-1R and TLR engagement. Review.
11960013 a novel member of the IRAK family with the properties of an IRAK-kinase

AA Sequence

MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSEL      1 - 70
LFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQN     71 - 140
LEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTV    141 - 210
AVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGT    211 - 280
PPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVG    281 - 350
TTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND    351 - 420
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS                                  421 - 460
//

Text Mined References (123)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26698383 2016 IRAK-4 deficiency as a cause for familial fatal invasive infection by Streptococcus pneumoniae.
26472314 2015 PID in Disguise: Molecular Diagnosis of IRAK-4 Deficiency in an Adult Previously Misdiagnosed With Autosomal Dominant Hyper IgE Syndrome.
26075815 2015 Association of Polymorphisms in IRAK1, IRAK4 and MyD88, and Severe Invasive Pneumococcal Disease.
25922567 2015 The dietary flavonoid Kaempferol mediates anti-inflammatory responses via the Src, Syk, IRAK1, and IRAK4 molecular targets.
25886387 2015 Rare variants in MYD88, IRAK4 and IKBKG and susceptibility to invasive pneumococcal disease: a population-based case-control study.
25479567 2015 Recent advances in the discovery of small molecule inhibitors of interleukin-1 receptor-associated kinase 4 (IRAK4) as a therapeutic target for inflammation and oncology disorders.
25344726 2014 A narrow repertoire of transcriptional modules responsive to pyogenic bacteria is impaired in patients carrying loss-of-function mutations in MYD88 or IRAK4.
25320238 2014 IRAK-4 and MyD88 deficiencies impair IgM responses against T-independent bacterial antigens.
25201411 2014 IRAK4 dimerization and trans-autophosphorylation are induced by Myddosome assembly.
24690905 2014 The role of interleukin-1 receptor-associated kinases in Vogt-Koyanagi-Harada disease.
24567333 2014 Interleukin 1/Toll-like receptor-induced autophosphorylation activates interleukin 1 receptor-associated kinase 4 and controls cytokine induction in a cell type-specific manner.
24316379 2014 Functional assessment of the mutational effects of human IRAK4 and MyD88 genes.
23595970 2013 Temozolomide-modulated glioma proteome: role of interleukin-1 receptor-associated kinase-4 (IRAK4) in chemosensitivity.
23591012 2013 A kinome-wide siRNA screen identifies multiple roles for protein kinases in hypoxic stress adaptation, including roles for IRAK4 and GAK in protection against apoptosis in VHL-/- renal carcinoma cells, despite activation of the NF-?B pathway.
23519847 2013 IRAK4 turns IL-10+ phospho-FOXO+ monocytes into pro-inflammatory cells by suppression of protein kinase B.
23376919 2013 IRAK-M mediates Toll-like receptor/IL-1R-induced NF?B activation and cytokine production.
23264652 2013 Regulation of TLR2-mediated tolerance and cross-tolerance through IRAK4 modulation by miR-132 and miR-212.
23255009 2012 Experimental and natural infections in MyD88- and IRAK-4-deficient mice and humans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23100432 2012 Loss of interleukin receptor-associated kinase 4 signaling suppresses amyloid pathology and alters microglial phenotype in a mouse model of Alzheimer's disease.
23041547 2012 Augmentation of therapeutic responses in melanoma by inhibition of IRAK-1,-4.
23027530 2012 Impaired innate immunity in mice deficient in interleukin-1 receptor-associated kinase 4 leads to defective type 1 T cell responses, B cell expansion, and enhanced susceptibility to infection with Toxoplasma gondii.
23002119 2012 IgM+IgD+CD27+ B cells are markedly reduced in IRAK-4-, MyD88-, and TIRAP- but not UNC-93B-deficient patients.
22932140 2012 [Association between single-nucleotide polymorphisms in the IRAK-4 gene and allergic rhinitis].
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22606974 2012 Effects of IL-1 receptor-associated kinase-4 gene silencing on human osteoblast-like cells.
22158417 2012 The death domain-containing protein Unc5CL is a novel MyD88-independent activator of the pro-inflammatory IRAK signaling cascade.
22059479 2012 Identification of interleukin-1 receptor-associated kinase 1 as a critical component that induces post-transcriptional activation of I?B-?.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21738793 2011 Association pattern of interleukin-1 receptor-associated kinase-4 gene polymorphisms with allergic rhinitis in a Han Chinese population.
21576904 2011 A nonsynonymous polymorphism of IRAK4 associated with increased prevalence of gram-positive infection and decreased response to toll-like receptor ligands.
21325272 2011 Natural loss-of-function mutation of myeloid differentiation protein 88 disrupts its ability to form Myddosomes.
21269878 2011 What the Myddosome structure tells us about the initiation of innate immunity.
21269460 2011 Initial characterization of the human central proteome.
21220427 2011 Endotoxin tolerance impairs IL-1 receptor-associated kinase (IRAK) 4 and TGF-beta-activated kinase 1 activation, K63-linked polyubiquitination and assembly of IRAK1, TNF receptor-associated factor 6, and IkappaB kinase gamma and increases A20 expression.
21205819 2011 Structure-function similarities between a plant receptor-like kinase and the human interleukin-1 receptor-associated kinase-4.
21166654 2011 Interleukin-1?-induced interleukin-6 production in A549 cells is mediated by both phosphatidylinositol 3-kinase and interleukin-1 receptor-associated kinase-4.
21160042 2011 Immune complex-mediated cell activation from systemic lupus erythematosus and rheumatoid arthritis patients elaborate different requirements for IRAK1/4 kinase activity across human cell types.
21057262 2010 Clinical features and outcome of patients with IRAK-4 and MyD88 deficiency.
20966070 2011 Two human MYD88 variants, S34Y and R98C, interfere with MyD88-IRAK4-myddosome assembly.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20621347 2010 Impaired T-cell receptor activation in IL-1 receptor-associated kinase-4-deficient patients.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485341 2010 Helical assembly in the MyD88-IRAK4-IRAK2 complex in TLR/IL-1R signalling.
20448286 2010 Association between anti-tumour necrosis factor treatment response and genetic variants within the TLR and NF{kappa}B signalling pathways.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20400509 2010 IRAK1 and IRAK4 promote phosphorylation, ubiquitination, and degradation of MyD88 adaptor-like (Mal).
20105294 2010 Robust TLR4-induced gene expression patterns are not an accurate indicator of human immunity.
20104875 2010 Steady-state kinetic characterization of kinase activity and requirements for Mg2+ of interleukin-1 receptor-associated kinase-4.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898481 2009 Genetic variants at CD28, PRDM1 and CD2/CD58 are associated with rheumatoid arthritis risk.
19703016 2009 HIV induces both a down-regulation of IRAK-4 that impairs TLR signalling and an up-regulation of the antibiotic peptide dermcidin in monocytic cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19663824 2009 Impaired neutrophil migration and phagocytosis in IRAK-4 deficiency.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19592493 2009 An oligomeric signaling platform formed by the Toll-like receptor signal transducers MyD88 and IRAK-4.
19505919 2009 Toll-like receptor signaling pathway variants and prostate cancer mortality.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19254290 2009 Polymorphisms in interleukin-1 receptor-associated kinase 4 are associated with total serum IgE.
19181383 2009 The kinase activities of interleukin-1 receptor associated kinase (IRAK)-1 and 4 are redundant in the control of inflammatory cytokine expression in human cells.
19120481 2009 Crosstalk between components of the innate immune system: promoting anti-microbial defenses and avoiding immunopathologies.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19006693 2008 IRAK-4- and MyD88-dependent pathways are essential for the removal of developing autoreactive B cells in humans.
18987746 2008 Association of interacting genes in the toll-like receptor signaling pathway and the antibody response to pertussis vaccination.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18503546 2008 MyD88-induced downregulation of IRAK-4 and its structural requirements.
18438411 2008 Sequential control of Toll-like receptor-dependent responses by IRAK1 and IRAK2.
18174872 2008 Staphylococcal pericarditis, and liver and paratracheal abscesses as presentations in two new cases of interleukin-1 receptor associated kinase 4 deficiency.
18079163 2008 IRAK-4-dependent degradation of IRAK-1 is a negative feedback signal for TLR-mediated NF-kappaB activation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17997719 2008 The IRAK-catalysed activation of the E3 ligase function of Pellino isoforms induces the Lys63-linked polyubiquitination of IRAK1.
17917042 2007 Inherited human IRAK-4 deficiency: an update.
17893200 2007 Selective predisposition to bacterial infections in IRAK-4-deficient children: IRAK-4-dependent TLRs are otherwise redundant in protective immunity.
17878374 2007 TLR9 activation induces normal neutrophil responses in a child with IRAK-4 deficiency: involvement of the direct PI3K pathway.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17675297 2007 Kinase-active interleukin-1 receptor-associated kinases promote polyubiquitination and degradation of the Pellino family: direct evidence for PELLINO proteins being ubiquitin-protein isopeptide ligases.
17548806 2007 Pivotal Advance: Inhibition of MyD88 dimerization and recruitment of IRAK1 and IRAK4 by a novel peptidomimetic compound.
17507369 2007 Mass spectrometric analysis of the endogenous type I interleukin-1 (IL-1) receptor signaling complex formed after IL-1 binding identifies IL-1RAcP, MyD88, and IRAK-4 as the stable components.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17337443 2007 IRAK-4 kinase activity is required for interleukin-1 (IL-1) receptor- and toll-like receptor 7-mediated signaling and gene expression.
17312103 2007 Cutting Edge: IL-1 receptor-associated kinase 4 structures reveal novel features and multiple conformations.
17217339 2007 Cross-talk between IRAK-4 and the NADPH oxidase.
17161373 2006 Crystal structures of IRAK-4 kinase in complex with inhibitors: a serine/threonine kinase with tyrosine as a gatekeeper.
17141195 2007 Regulation of IRAK-4 kinase activity via autophosphorylation within its activation loop.
17046325 2006 IRAK-4--a shared NF-kappaB activator in innate and acquired immunity.
16951688 2006 Smad6 negatively regulates interleukin 1-receptor-Toll-like receptor signaling through direct interaction with the adaptor Pellino-1.
16950813 2007 IRAK4 and NEMO mutations in otherwise healthy children with recurrent invasive pneumococcal disease.
16907704 2006 Lack of association between genetic variation in 9 innate immunity genes and baseline CRP levels.
16541075 2006 The finished DNA sequence of human chromosome 12.
16537705 2006 Interactions of sequence variants in interleukin-1 receptor-associated kinase4 and the toll-like receptor 6-1-10 gene cluster increase prostate cancer risk.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16286016 2005 IL-33, an interleukin-1-like cytokine that signals via the IL-1 receptor-related protein ST2 and induces T helper type 2-associated cytokines.
16286015 2005 Human TLR-7-, -8-, and -9-mediated induction of IFN-alpha/beta and -lambda Is IRAK-4 dependent and redundant for protective immunity to viruses.
16024789 2005 A novel splice variant of interleukin-1 receptor (IL-1R)-associated kinase 1 plays a negative regulatory role in Toll/IL-1R-induced inflammatory signaling.
15905496 2005 Cutting edge: expression of IL-1 receptor-associated kinase-4 (IRAK-4) proteins with mutations identified in a patient with recurrent bacterial infections alters normal IRAK-4 interaction with components of the IL-1 receptor complex.
15825022 2005 Shigella sonnei meningitis due to interleukin-1 receptor-associated kinase-4 deficiency: first association with a primary immune deficiency.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15292196 2004 The role of interleukin 1 receptor-associated kinase-4 (IRAK-4) kinase activity in IRAK-4-mediated signaling.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15084582 2004 IRAK4 kinase activity is redundant for interleukin-1 (IL-1) receptor-associated kinase phosphorylation and IL-1 responsiveness.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14625308 2004 Sequential autophosphorylation steps in the interleukin-1 receptor-associated kinase-1 regulate its availability as an adapter in interleukin-1 signaling.
12925671 2003 Distinct mutations in IRAK-4 confer hyporesponsiveness to lipopolysaccharide and interleukin-1 in a patient with recurrent bacterial infections.
12860405 2003 Characterization of Pellino2, a substrate of IRAK1 and IRAK4.
12721283 2003 TIRP, a novel Toll/interleukin-1 receptor (TIR) domain-containing adapter protein involved in TIR signaling.
12637671 2003 Pyogenic bacterial infections in humans with IRAK-4 deficiency.
12538665 2003 Inhibition of interleukin 1 receptor/Toll-like receptor signaling through the alternatively spliced, short form of MyD88 is due to its failure to recruit IRAK-4.
12496252 2003 Pellino 1 is required for interleukin-1 (IL-1)-mediated signaling through its interaction with the IL-1 receptor-associated kinase 4 (IRAK4)-IRAK-tumor necrosis factor receptor-associated factor 6 (TRAF6) complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12297423 2002 IRAK-4 as the central TIR signaling mediator in innate immunity.
11960013 2002 IRAK-4: a novel member of the IRAK family with the properties of an IRAK-kinase.
11923871 2002 Severe impairment of interleukin-1 and Toll-like receptor signalling in mice lacking IRAK-4.
10854325 2000 Tollip, a new component of the IL-1RI pathway, links IRAK to the IL-1 receptor.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
3772297 1986 Analysis of a human V beta gene subfamily.