Property Summary

Ligand Count 15
NCBI Gene PubMed Count 189
PubMed Score 348.84
PubTator Score 242.31

Knowledge Summary

Patent (10,866)

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.301 3.1e-06
astrocytoma 1.100 4.3e-20
atypical teratoid / rhabdoid tumor 1.200 2.9e-03
colon cancer 1.800 1.4e-02
glioblastoma 1.100 8.1e-06
inflammatory breast cancer 1.200 1.3e-02
lung cancer 1.300 6.1e-03
medulloblastoma, large-cell 1.300 4.5e-05
non primary Sjogren syndrome sicca 1.300 3.5e-02
ovarian cancer 2.100 8.4e-06
pediatric high grade glioma 1.400 6.5e-04
psoriasis 1.600 1.3e-04

Protein-protein Interaction (1)

Gene RIF (134)

AA Sequence

MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVL      1 - 70
WPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSAS     71 - 140
TFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPFPFCWPLCEISRGTH    141 - 210
NFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQ    211 - 280
NGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDE    281 - 350
RLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG    351 - 420
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDPRPGPCPPELG    421 - 490
LGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPPSPQENSYVSSTGRAHSGAAP    491 - 560
WQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGESS    561 - 630
WGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQD    631 - 700
RQGPEESDEFQS                                                              701 - 712
//

Text Mined References (203)

PMID Year Title