Property Summary

NCBI Gene PubMed Count 174
PubMed Score 320.43
PubTator Score 242.31

Knowledge Summary

Patent (10,866)

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis 1.600 1.3e-04
astrocytoma 1.900 1.4e-03
glioblastoma 1.800 1.4e-03
atypical teratoid / rhabdoid tumor 1.200 2.9e-03
medulloblastoma, large-cell 1.300 4.5e-05
acute quadriplegic myopathy 1.301 3.1e-06
lung cancer 1.300 6.1e-03
colon cancer 1.800 1.4e-02
pediatric high grade glioma 1.400 6.5e-04
non primary Sjogren syndrome sicca 1.300 3.5e-02
inflammatory breast cancer 1.200 1.3e-02
ovarian cancer 2.100 8.4e-06

Protein-protein Interaction (7)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (122)

PMID Text
26527316 Our findings reveal that IRAK1 promotes cell survival and is an attractive therapeutic target in head and neck squamous cell carcinomas
26503059 IRAK1 overexpression drive aggressive growth, metastasis and acquired resistance to paclitaxel treatment in breast cancer.
26151128 miR146a has an important promoting effect on the apoptosis of granulosa cells by targeting IRAK1 and TRAF6 via the caspase cascade pathway
26142671 These data demonstrated that these three single nucleotide polymorphisms (rs3027898, rs1059702, rs1059703) in IRAK1 were associated with autoimmune diseases risk.
26075815 This is the first study to show an association between single nucleotide polymorphisms in IRAK1, IRAK4 and MyD88, and the presence of severe invasive pneumococcal disease.
25955717 Data suggest that TLR2 (toll like receptor 2) is down-regulated by microRNA-UL112-3p from human Cytomegalovirus; microRNA-UL112-3p also down-regulates TLR2-induced post-translational activation of IRAK1 signaling.
25922567 Src, Syk, IRAK1, and IRAK4 have roles in anti-inflammatory responses mediated by dietary flavonoid Kaempferol
25550857 expression of IRAK1 in lung cancer was significantly higher compared with that in normal lung tissues and was correlated with TNM stage, lymphatic metastasis and tumor size.
25505246 MicroRNA-146a and microRNA-146b regulate human dendritic cell apoptosis and cytokine production by targeting TRAF6 and IRAK1 proteins.
25472883 HIV-1 Tat specifically associates with IRAK1 promoter to downregulate IRAK1 expression in T cells
25458699 results firstly indicated that IRAK1 and MECP2 genes are crucial risk factors for AITDs.
25341731 IRAK1 was constitutively phosphorylated in PEL and required for survival, implicating IRAK1 and TLR signaling as a driver pathway in PEL
25294684 IL-1beta stimulation causes sequential phosphorylation of IRAK-1, c-Jun N-terminal kinase, and p300 and enhances recruitment of the p300/CBP/NF-Y complex to Gankyrin promoter
25269878 This meta-analysis suggests that the miR-499 rs374644 and IRAKI rs3027898 polymorphisms are associated with susceptibility to inflammatory arthritis. [review]
25203887 The IRAK1 polymorphism is a strong independent predictor of multiple organ failure and mortality postinjury and represents a common variant with prognostic potential.
24857403 A direct interaction between IRAK1 and vasodilator-stimulated phosphoprotein (VASP) is regulated in part by assembly of IRAK1.
24709033 IRAK1 rs1059702 genetic variant do not play a significant role in giant cell arteritis susceptibility or severity.
24690905 High mRNA levels of IRAK1 and IRAK4 correlated with VKH disease activity.
24469975 Data indicate that acetyl-11-keto-beta-boswellic acid (AKBA) is able to decrease Th17 differentiation by inhibition of IL-1beta signaling via reduction of IL-1 receptor-associated kinase 1 (IRAK1) phosphorylation.
24302991 miR-146a enhances the oncogenicity of oral carcinoma by concomitant targeting of the IRAK1, TRAF6 and NUMB genes.
23867959 Female very low birth weight infants heterozygous for the X-linked IRAK1 (rs1059703) SNP had lessgram negative bacterial infections.
23794009 Significantly lower levels of IRAK-1 was found in CAD patients with the CC genotype.
23633945 results indicate that miR-21 is upregulated during hepatitis C virus infection and negatively regulates IFN-alpha signaling through MyD88 and IRAK1
23444193 The data suggest the existence of two independent signals within the Xq28 region, one in IRAK1 related to pulmonary fibrosis and another in MECP2 related to diffuse cutaneous systemic sclerosis.
23435933 The polymorphisms rs3027898 and rs1059702 of IRAK1 gene are associated with systemic lupus erythematosus in the Chinese Han population.
23428850 Data suggest that the lupus-associated variant in the MECP2/IRAK1 locus has the potential to affect all 3 epigenetic mechanisms: DNA methylation, microRNA expression, and histone modification.
23396947 IRAK1 regulates interferon (IFN)-beta and proinflammatory cytokine production downstream of Toll-like receptor (TLR)3.
23383610 IRAK1, CHEK1 and BUB1 are overexpressed in, and may play an important role in ovarian cancer.
23233309 Single nucleotide polymorphisms encoding for pPhe196Ser and pSer532Leu confers enhanced IRAK1 activity and, consequently, enhanced susceptibility to rheumatoid arthritis, as compared to the minor haplotype.
23041547 Evaluates the effects of stimulating or inhibiting the TLR/IL-1 receptor-associated kinases IRAK-1 and IRAK-4 in melanoma cells where their functions are largely unexplored.
23018031 expression of miR-146a was up-regulated both in lesions and PBMCs of psoriatic patients, and positively correlated with IL-17 expression, whereas the target gene IRAK1 expression was expressed differentially in lesions and peripheral blood.
22904263 These data suggest contributions of both IRAK1 and MECP2 to systemic lupus erythematosus susceptibility.
22896623 Reanalysis of the array data set identified myeloid differentiation primary response protein 88 (MYD88) in addition to IRAK1 as a potential target of Kaposi's sarcoma-associated herpesvirus microRNAs.
22851693 Knockdown of beta-TrCP1 and beta-TrCP2 attenuated the K48-linked ubiquitination and degradation of IRAK1.
22759955 IRAK1 plays an important role in TNF-alpha-induced nulcear factor kappa B activation in human bone marrow mesenchymal stem cells.
22451023 functional SNP IRAK1 rs3027898 C/A variant allele is associated with the development of rheumatoid arthritis.
22059479 investigation of signaling components that induce activation of post-transcriptional mechanism for IkappaB-zeta induction/activation: Activation of IRAK1 or IRAK4, but not TRAF6, is sufficient.
22033459 Results indicate that stimulation of TLRs induces proteasome-dependent downregulation of TRAF6, and that TRAF6 associated with ubiquitinated IRAK-1 is degraded together by the proteasome.
22033216 decreased expression in the peripheral mononuclear cells of patients with Sjogren's syndrome
21933552 The functional polymorphism in exon 5 and the variant haplotype of IRAK1 gene mediate susceptibility to and severity of sepsis. IRAK1 might be a genetic risk factor for the occurrence and development of sepsis in the Chinese population.
21898345 There is an association between IRAK1 and systemic sclerosis (SSc), demonstrating that a sex chromosome gene directly influences SSc susceptibility and its phenotypic heterogeneity.
21804018 the results obtained demonstrate for the first time that IRAK1 and PKCdelta functionally interact to regulate IL-1beta production in monocytic cells
21708940 NSMase-2- and PP2A-dependent regulation of IRAK-1 degradation is a novel mechanism to fine tune the magnitude of IL-1beta response.
21640790 Up-regulated miRNA-146a targets several inflammation-related mRNAs, including those encoding complement factor-H (CFH) and interleukin-1 receptor associated kinase-1 (IRAK-1), resulting in significant decreases in their expression.
21537341 These results indicate a crucial role for IRAK-1 in bacterial lipoprotein -induced tolerance, and suggest IRAK-1 as a potential target for manipulation of the TLR-mediated inflammatory response during microbial sepsis.
21220427 LPS-induced activation of IRAK4 and TAK1, K63-linked polyubiquitination of IRAK1 and TRAF6, and disrupted IRAK1-TRAF6 and IRAK1-IKKgamma assembly associated with increased A20 expression
21160042 Although IRAK4 kinase activity is essential for human plasmacytoid dendritic cell activation, it is dispensable in B, T, dendritic, and monocytic cells, which is in contrast with an essential active kinase role in comparable mouse cell types.
20937840 analysis of differential regulation of interleukin-1 receptor-associated kinase-1 (IRAK-1) and IRAK-2 by microRNA-146a and NF-kappaB in stressed human astroglial cells and in Alzheimer disease
20890200 IRAK1 variant haplotype is associated with prolonged ventilation in septic shock.
20890200 Observational study of gene-disease association. (HuGE Navigator)
20870441 Significant difference was observed in the distribution of IRAK1 rs3027898 genotypes between rheumatoid arthritis patients and controls.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20619458 Leptin increases the expression of IRAK-1 in human monocytes.
20542134 In conclusion, Helicobacter pylori-induced miR-146a plays a potential role in a negative feedback loop to modulate the inflammation by targeting IRAK1 and TRAF6.
20500689 Marginally significant difference was observed in distribution of IRAK1 rs1059703 genotypes between patients with psoriatic arthritis and controls (P = 0.058), but no difference was observed in miRNA-146a rs2910164 distribution (P = 0.394).
20500689 Observational study of gene-disease association. (HuGE Navigator)
20463618 Observational study of gene-disease association. (HuGE Navigator)
20448286 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20400509 Mal is a substrate for IRAK1 and IRAK4 with phosphorylation promoting ubiquitination and degradation of Mal, which may serve to negatively regulate signaling by TLR2 and TLR4
20092701 Reduced IRAK-1 protein expression is an important mechanism in the development of bacterial lipoprotein-induced tolerance.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20044140 IRAK-1 forms a close complex with PKCepsilon as well as VASP, and participates in phorbol 12-myristate 13-acetate-induced phosphorylation of VASP.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19838195 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19716405 DSCR1-1S isoform positively modulates IL-1R-mediated signaling pathways by regulating Tollip/IRAK-1/TRAF6 complex formation.
19505919 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19329491 forward genetic studies in human systemic lupus erythematosus and the mechanistic studies in mouse models establish IRAK1 as a disease gene in lupus, capable of modulating at least 2 key checkpoints in disease development
19329491 Observational study of gene-disease association. (HuGE Navigator)
19288030 Results suggest that ALOX5AP, IRAK1, and FABP2 are susceptibility loci for CKD among Japanese individuals with type 2 diabetes mellitus.
19282863 Observational study of gene-disease association. (HuGE Navigator)
19264973 multiple SNP associations were replicated in both IRAK-3 and ORMDL3, these likely reflect a single disease susceptibility locus in each gene
19181383 In human cells the non-kinase functions of IRAK-4 are essential, whereas the kinase activity of IRAK-4 appears redundant with that of IRAK-1.
19166933 Over-expression of interleukin-1 receptor-associated kinase-1 led to increased constitutive and cytokine induced production of Chemokines, CC.
19166926 Interleukin-1 Receptor-Associated Kinase is held in a closed, inactive conformation via an intramolecular mechanism involving its C-terminal domain and possibly the death domain.
19104650 Leishmania can exploit a host protein tyrosine phosphatase, namely SHP-1, to directly inactivate IRAK-1.
19025640 TLR-ligands can render DCs tolerant with respect to TNF gene expression by a mechanism that likely involves blockade of signal transduction at the level of IRAK-1.
18987746 Significant & strong 2- & 3-locus interactions between SNPs in TOLLIP (rs4963060), TLR4 (rs6478317) & IRAK1 (rs1059703)were associated with the response to whole-cell vaccine pertussis vaccination in 490 1-yr-old children.
18987746 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18566305 Observational study of gene-disease association. (HuGE Navigator)
18474871 Observational study of gene-disease association. (HuGE Navigator)
18411265 signals from the IL-1 receptor segregate into at least two separate pathways at the level of IRAK1; one couples through TRAF6 to NFkappaB activation while a second utilizes a TRAF6-independent pathway that is responsible for mRNA stabilization
18347055 The sites of IRAK-1 ubiquitination were mapped to Lys134 and Lys180, and arginine substitution of these residues impaired IL-1R/TLR-mediated IRAK-1 ubiquitination.
18276832 Both cytosolic and nuclear actions of IRAK-1 participate in the activation of NF-kappaB-dependent transcriptional events.
18079163 These results suggested that the expression of IRAK-4 alone is sufficient to cause the degradation of IRAK-1; the autophosphorylation of IRAK-1 is not necessary to terminate the TLR-induced activation of NF-kappaB.
18070982 TRAF6 is involved but with different mechanisms of IRAK-1-induced activation of NF-kappaB.
18050247 SELP and IRAK1 were identified as novel SLE-associated genes with a high degree of significance, suggesting new directions in understanding the pathogenesis of systemic lupus erythematosus.
17997719 Pellino isoforms may be the E3 ubiquitin ligases that mediate the IL-1-stimulated formation of K63-pUb-IRAK1 in cells, which may contribute to activation of IKKbeta and transcription factor NF-kappaB, as well as signalling pathways dependent on IRAK1/4
17920759 Constitutive association of MyD88 with IRAK1 was observed in all three of HTLV-I-transformed T cells, but not in HTLV-I-negative T cells
17905570 MyD88, IRAK1 and TRAF6 proteins are crucial early mediators for the IL-1-induced MMP-13 regulation through MAPK pathways and AP-1 activity.
17878161 IRAK-2 plays a more central role than IRAK-1 in TLR signaling to NFkappaB through TRAF6 ubiquitination
17785851 Variant IRAK-1 is associated with alterations in multiple intracellular events that are likely to contribute to increased NF-kappa B activation and inflammatory responses in individuals with this commonly occurring IRAK-1 variant haplotype.
17675297 kinase-inactive IRAK proteins can associate with Pellino proteins, thus excluding the possibility that their inability to regulate Pellino degradation is due to lack of association with the Pellino proteins
17548806 ST2825 interfered with recruitment of IRAK1 and IRAK4 by MyD88, causing inhibition of IL-1beta-mediated activation of NF-kappaB transcriptional activity.
17382928 Observational study of gene-disease association. (HuGE Navigator)
17382928 variation in the IRAK1 gene is associated with C-reactive protein concentration in Caucasian women in the Diabetes Heart Study
17276401 Death domain of IRAK-1 is a multimerization domain which mediates association towards MyD88, Tollip, Irak-4 & Irak-1.
17053167 ozLDL inhibited NF-kappaB and IRAK-1-associated signaling which may impair immune function and promote apoptosis
16907704 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16831874 Data show that IRAK-1 acts as the essential upstream adaptor that recruits BCL10 to the TLR4 signaling complex and mediates signaling to NF-kappaB through the BCL10-MALT1-TRAF6-TAK1 cascade.
16537705 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16528020 Observational study of gene-disease association. (HuGE Navigator)
16477006 The critical IRAK1 role in LMP1-induced NF-kappaB activation is in mediating p65/RelA S536 phosphorylation through an effect on p38 or other p65 S536 kinases.
16203735 Monarch-1 associates with IRAK-1 but not MyD88, resulting in the blockage of IRAK-1 hyperphosphorylation
16107720 following stimulation by exogenous CD26, Tollip and IRAK-1 dissociate from caveolin-1, and IRAK-1 is then phosphorylated in the cytosol, leading to the upregulation of CD86 via activation of NF-kappaB
16024789 Presence of a regulated, alternative splice variant of IRAK1 that functions as a kinase-dead, dominant-negative protein adds further complexity to the variety of mechanisms that regulate Toll/IL-1 receptor signaling and subsequent inflammatory response.
15829295 Only LPS, not taxol, caused a dramatic decrease in IRAK1 protein levels.
15647277 the Hsp90.Cdc37 molecular chaperone module has a central role in interleukin-1 receptor-associated-kinase-dependent signaling by toll-like receptors
15523691 study shows that PBMCs of patients with advanced gastric cancer show poor production of TNF and IL-12p40 in response to stimulation with tumor cells in vitro & this unresponsiveness is associated in some patients with diminished IRAK-1 expression in vivo
15465816 IRAK1 is essential for lipopolysaccharide-induced interleukin-10 gene expression
15069085 Involvement of CD14/TLR4, CR3, and phosphatidylinositol 3-kinase in the degradation of IL-1 receptor-associated kinase in response to LPS.
14752294 IRAK-1 is the central kinase involved in the activation of the macrophage at distant sites during septic shock
12860405 Pellino2 interacts with kinase-active as well as kinase-inactive IRAK1 and IRAK4
12856330 phosphorylates Stat1 on serine 727 in response to interleukin-1 and affects gene expression
12619925 Observational study of gene-disease association. (HuGE Navigator)
12619925 association of a haplotype (196Phe/532Ser) in the interleukin-1-receptor-associated kinase (IRAK1) gene with low radial bone mineral density in two independent populations
12391239 In lipopolysaccharide (LPS)-tolerant monocytes IRAK-1 is not activated in response to LPS restimulation, although protein and mRNA levels remain normal or slightly up-regulated.
12138165 Identification of threonine 66 as a functionally critical residue of the protein
12055225 Down-regulation of the common Toll-like receptor intracellular signaling factor IRAK in vitro will lead to a state of cross-tolerance and decreased IL-1 beta and TNF-alpha production upon subsequent challenge with multiple microbial toxins.
11953430 Gram-negative flagellin-induced self-tolerance is associated with a block in interleukin-1 receptor-associated kinase release from toll-like receptor 5.
11777917 proximal signaling molecules involved in LPS-induced NF-kappa B activation have a requisite involvement in LPS-induced apoptosis and that the pathways leading to NF-kappa B activation and apoptosis diverge downstream of IRAK-1.

AA Sequence

MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVL      1 - 70
WPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSAS     71 - 140
TFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPFPFCWPLCEISRGTH    141 - 210
NFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQ    211 - 280
NGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDE    281 - 350
RLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG    351 - 420
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDPRPGPCPPELG    421 - 490
LGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPPSPQENSYVSSTGRAHSGAAP    491 - 560
WQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGESS    561 - 630
WGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQD    631 - 700
RQGPEESDEFQS                                                              701 - 712
//

Text Mined References (187)

PMID Year Title
26527316 2015 IRAK1 is a novel DEK transcriptional target and is essential for head and neck cancer cell survival.
26503059 2015 IRAK1 is a therapeutic target that drives breast cancer metastasis and resistance to paclitaxel.
26151128 2015 Downregulation of microRNA?146a inhibits ovarian granulosa cell apoptosis by simultaneously targeting interleukin?1 receptor?associated kinase and tumor necrosis factor receptor?associated factor 6.
26142671 2015 Susceptibility of autoimmune diseases in three polymorphisms of infection-associated gene IRAK1.
26075815 2015 Association of Polymorphisms in IRAK1, IRAK4 and MyD88, and Severe Invasive Pneumococcal Disease.
25955717 2015 Human Cytomegalovirus miR-UL112-3p Targets TLR2 and Modulates the TLR2/IRAK1/NF?B Signaling Pathway.
25922567 2015 The dietary flavonoid Kaempferol mediates anti-inflammatory responses via the Src, Syk, IRAK1, and IRAK4 molecular targets.
25550857 2014 Expression of IRAK1 in lung cancer tissues and its clinicopathological significance: a microarray study.
25505246 2015 MicroRNA-146a and microRNA-146b regulate human dendritic cell apoptosis and cytokine production by targeting TRAF6 and IRAK1 proteins.
25458699 2015 Variants in IRAK1-MECP2 region confer susceptibility to autoimmune thyroid diseases.
25341731 2014 Interleukin 1 receptor-associated kinase 1 (IRAK1) mutation is a common, essential driver for Kaposi sarcoma herpesvirus lymphoma.
25294684 2015 Interleukin-1?/Iinterleukin-1 receptor-associated kinase 1 inflammatory signaling contributes to persistent Gankyrin activation during hepatocarcinogenesis.
25269878 2015 The association between susceptibility to inflammatory arthritis and miR-146a, miR-499 and IRAK1 polymorphisms. A meta-analysis.
25203887 2014 X chromosome-linked IRAK-1 polymorphism is a strong predictor of multiple organ failure and mortality postinjury.
24857403 2014 Isomerase-catalyzed binding of interleukin-1 receptor-associated kinase 1 to the EVH1 domain of vasodilator-stimulated phosphoprotein.
24709033 Analysis of two autoimmunity genes, IRAK1 and MECP2, in giant cell arteritis.
24690905 2014 The role of interleukin-1 receptor-associated kinases in Vogt-Koyanagi-Harada disease.
24469975 2014 Boswellic acids reduce Th17 differentiation via blockade of IL-1?-mediated IRAK1 signaling.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24302991 2013 miR-146a enhances the oncogenicity of oral carcinoma by concomitant targeting of the IRAK1, TRAF6 and NUMB genes.
23867959 2013 Toll-like receptor genetic variants are associated with Gram-negative infections in VLBW infants.
23794009 2014 miR-146a polymorphism influences levels of miR-146a, IRAK-1, and TRAF-6 in young patients with coronary artery disease.
23633945 2013 HCV-induced miR-21 contributes to evasion of host immune system by targeting MyD88 and IRAK1.
23444193 2013 New insight on the Xq28 association with systemic sclerosis.
23435933 2013 Association of interleukin-1 receptor-associated kinase (IRAK1) gene polymorphisms (rs3027898, rs1059702) with systemic lupus erythematosus in a Chinese Han population.
23428850 2013 Functional characterization of the MECP2/IRAK1 lupus risk haplotype in human T cells and a human MECP2 transgenic mouse.
23396947 2013 A novel IRAK1-IKK? signaling axis limits the activation of TAK1-IKK? downstream of TLR3.
23383610 2013 Identification of ovarian cancer associated genes using an integrated approach in a Boolean framework.
23233309 2013 Association of an activity-enhancing variant of IRAK1 and an MECP2-IRAK1 haplotype with increased susceptibility to rheumatoid arthritis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23041547 2012 Augmentation of therapeutic responses in melanoma by inhibition of IRAK-1,-4.
23018031 2012 Dysregulation of miRNA146a versus IRAK1 induces IL-17 persistence in the psoriatic skin lesions.
22904263 2013 Fine mapping of Xq28: both MECP2 and IRAK1 contribute to risk for systemic lupus erythematosus in multiple ancestral groups.
22896623 2012 Kaposi's sarcoma-associated herpesvirus microRNAs target IRAK1 and MYD88, two components of the toll-like receptor/interleukin-1R signaling cascade, to reduce inflammatory-cytokine expression.
22851693 2012 ?-TrCP-mediated IRAK1 degradation releases TAK1-TRAF6 from the membrane to the cytosol for TAK1-dependent NF-?B activation.
22759955 2012 Role of IRAK1 on TNF-induced proliferation and NF-?B activation in human bone marrow mesenchymal stem cells.
22451023 2013 IRAK1 rs3027898 C/A polymorphism is associated with risk of rheumatoid arthritis.
22158417 2012 The death domain-containing protein Unc5CL is a novel MyD88-independent activator of the pro-inflammatory IRAK signaling cascade.
22059479 2012 Identification of interleukin-1 receptor-associated kinase 1 as a critical component that induces post-transcriptional activation of I?B-?.
22037600 2011 The I?B kinase complex regulates the stability of cytokine-encoding mRNA induced by TLR-IL-1R by controlling degradation of regnase-1.
22033459 2012 IRAK-1-mediated negative regulation of Toll-like receptor signaling through proteasome-dependent downregulation of TRAF6.
22033216 2012 Increased microRNA-146a/b, TRAF6 gene and decreased IRAK1 gene expressions in the peripheral mononuclear cells of patients with Sjögren's syndrome.
21933552 2011 Functional polymorphism in exon 5 and variant haplotype of the interleukin-1 receptor-associated kinase 1 gene are associated with susceptibility to and severity of sepsis in the Chinese population.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21898345 2011 Evidence of the contribution of the X chromosome to systemic sclerosis susceptibility: association with the functional IRAK1 196Phe/532Ser haplotype.
21804018 2011 IL-1R-associated kinase-1 mediates protein kinase C?-induced IL-1? production in monocytes.
21743479 2011 Essential role for the prolyl isomerase Pin1 in Toll-like receptor signaling and type I interferon-mediated immunity.
21708940 2011 Protein phosphatase 2A and neutral sphingomyelinase 2 regulate IRAK-1 protein ubiquitination and degradation in response to interleukin-1beta.
21640790 2011 Differential expression of miRNA-146a-regulated inflammatory genes in human primary neural, astroglial and microglial cells.
21537341 2012 Bacterial lipoprotein-induced tolerance is reversed by overexpression of IRAK-1.
21269460 2011 Initial characterization of the human central proteome.
21220427 2011 Endotoxin tolerance impairs IL-1 receptor-associated kinase (IRAK) 4 and TGF-beta-activated kinase 1 activation, K63-linked polyubiquitination and assembly of IRAK1, TNF receptor-associated factor 6, and IkappaB kinase gamma and increases A20 expression.
21160042 2011 Immune complex-mediated cell activation from systemic lupus erythematosus and rheumatoid arthritis patients elaborate different requirements for IRAK1/4 kinase activity across human cell types.
20937840 2010 Differential regulation of interleukin-1 receptor-associated kinase-1 (IRAK-1) and IRAK-2 by microRNA-146a and NF-kappaB in stressed human astroglial cells and in Alzheimer disease.
20890200 2010 IRAK1 functional genetic variant affects severity of septic shock.
20870441 2010 A polymorphism in the 3'-UTR of interleukin-1 receptor-associated kinase (IRAK1), a target gene of miR-146a, is associated with rheumatoid arthritis susceptibility.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20619458 2010 Molecular mechanism underlying the inflammatory complication of leptin in macrophages.
20542134 2010 Up-regulated microRNA-146a negatively modulate Helicobacter pylori-induced inflammatory response in human gastric epithelial cells.
20500689 2010 The role of microRNA-146a (miR-146a) and its target IL-1R-associated kinase (IRAK1) in psoriatic arthritis susceptibility.
20463618 2010 Role of polymorphic variants as genetic modulators of infection in neonatal sepsis.
20448286 2010 Association between anti-tumour necrosis factor treatment response and genetic variants within the TLR and NF{kappa}B signalling pathways.
20400509 2010 IRAK1 and IRAK4 promote phosphorylation, ubiquitination, and degradation of MyD88 adaptor-like (Mal).
20092701 2010 [The influence of over expression of interleukin-1 receptor-associated kinase 1 on bacterial lipoprotein-induced tolerance].
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20044140 2010 Interleukin-1 Receptor-Associated Kinase-1 (IRAK-1) functionally associates with PKCepsilon and VASP in the regulation of macrophage migration.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19838195 2009 A large-scale replication study identifies TNIP1, PRDM1, JAZF1, UHRF1BP1 and IL10 as risk loci for systemic lupus erythematosus.
19716405 2009 Down syndrome candidate region-1 protein interacts with Tollip and positively modulates interleukin-1 receptor-mediated signaling.
19675569 2009 Direct activation of protein kinases by unanchored polyubiquitin chains.
19505919 2009 Toll-like receptor signaling pathway variants and prostate cancer mortality.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19329491 2009 Identification of IRAK1 as a risk gene with critical role in the pathogenesis of systemic lupus erythematosus.
19288030 2009 Association of genetic variants with chronic kidney disease in Japanese individuals with type 2 diabetes mellitus.
19282863 2009 Association of candidate gene polymorphisms with chronic kidney disease in Japanese individuals with hypertension.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19181383 2009 The kinase activities of interleukin-1 receptor associated kinase (IRAK)-1 and 4 are redundant in the control of inflammatory cytokine expression in human cells.
19166933 2009 Interleukin-1 regulates keratinocyte expression of T cell targeting chemokines through interleukin-1 receptor associated kinase-1 (IRAK1) dependent and independent pathways.
19166926 2009 Regulation of IRAK-1 activation by its C-terminal domain.
19104650 2008 Leishmania-induced IRAK-1 inactivation is mediated by SHP-1 interacting with an evolutionarily conserved KTIM motif.
19025640 2008 Tolerance induced via TLR2 and TLR4 in human dendritic cells: role of IRAK-1.
19022706 2009 The Pellino family: IRAK E3 ligases with emerging roles in innate immune signalling.
18987746 2008 Association of interacting genes in the toll-like receptor signaling pathway and the antibody response to pertussis vaccination.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18566305 2008 Genetic factors for ischemic and hemorrhagic stroke in Japanese individuals.
18474871 2008 Common SNP in pre-miR-146a decreases mature miR expression and predisposes to papillary thyroid carcinoma.
18411265 2008 Interleukin 1alpha-induced NFkappaB activation and chemokine mRNA stabilization diverge at IRAK1.
18347055 2008 Lys63-linked polyubiquitination of IRAK-1 is required for interleukin-1 receptor- and toll-like receptor-mediated NF-kappaB activation.
18276832 2008 Interleukin-1 receptor-associated kinase (IRAK) -1-mediated NF-kappaB activation requires cytosolic and nuclear activity.
18079163 2008 IRAK-4-dependent degradation of IRAK-1 is a negative feedback signal for TLR-mediated NF-kappaB activation.
18070982 2008 TRAF6 distinctively mediates MyD88- and IRAK-1-induced activation of NF-kappaB.
18050247 2007 Identification of novel susceptibility genes in childhood-onset systemic lupus erythematosus using a uniquely designed candidate gene pathway platform.
17997719 2008 The IRAK-catalysed activation of the E3 ligase function of Pellino isoforms induces the Lys63-linked polyubiquitination of IRAK1.
17920759 2007 Constitutive association of MyD88 to IRAK in HTLV-I-transformed T cells.
17905570 2007 MyD88, IRAK1 and TRAF6 knockdown in human chondrocytes inhibits interleukin-1-induced matrix metalloproteinase-13 gene expression and promoter activity by impairing MAP kinase activation.
17890055 2008 IRAK1: a critical signaling mediator of innate immunity.
17878161 2007 IRAK-2 participates in multiple toll-like receptor signaling pathways to NFkappaB via activation of TRAF6 ubiquitination.
17785851 2007 Variant IL-1 receptor-associated kinase-1 mediates increased NF-kappa B activity.
17675297 2007 Kinase-active interleukin-1 receptor-associated kinases promote polyubiquitination and degradation of the Pellino family: direct evidence for PELLINO proteins being ubiquitin-protein isopeptide ligases.
17567694 2007 Hepatitis C virus nonstructural protein 5A modulates the toll-like receptor-MyD88-dependent signaling pathway in macrophage cell lines.
17548806 2007 Pivotal Advance: Inhibition of MyD88 dimerization and recruitment of IRAK1 and IRAK4 by a novel peptidomimetic compound.
17382928 2007 The association between innate immunity gene (IRAK1) and C-reactive protein in the Diabetes Heart Study.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17276401 2007 The death domain of IRAK-1: an oligomerization domain mediating interactions with MyD88, Tollip, IRAK-1, and IRAK-4.
17053167 2007 Ozonized low density lipoprotein (ozLDL) inhibits NF-kappaB and IRAK-1-associated signaling.
16997282 2006 NF-kappaB functions in the nervous system: from development to disease.
16951688 2006 Smad6 negatively regulates interleukin 1-receptor-Toll-like receptor signaling through direct interaction with the adaptor Pellino-1.
16907704 2006 Lack of association between genetic variation in 9 innate immunity genes and baseline CRP levels.
16884718 2006 Pellino proteins are more than scaffold proteins in TLR/IL-1R signalling: a role as novel RING E3-ubiquitin-ligases.
16831874 2006 The IRAK-1-BCL10-MALT1-TRAF6-TAK1 cascade mediates signaling to NF-kappaB from Toll-like receptor 4.
16690127 2007 Differential regulation of interleukin-1 receptor associated kinase 1 (IRAK1) splice variants.
16537705 2006 Interactions of sequence variants in interleukin-1 receptor-associated kinase4 and the toll-like receptor 6-1-10 gene cluster increase prostate cancer risk.
16528020 2006 Variant IRAK-1 haplotype is associated with increased nuclear factor-kappaB activation and worse outcomes in sepsis.
16477006 2006 IL-1 receptor-associated kinase 1 is critical for latent membrane protein 1-induced p65/RelA serine 536 phosphorylation and NF-kappaB activation.
16381901 2006 The LIFEdb database in 2006.
16286016 2005 IL-33, an interleukin-1-like cytokine that signals via the IL-1 receptor-related protein ST2 and induces T helper type 2-associated cytokines.
16203735 2005 The CATERPILLER protein monarch-1 is an antagonist of toll-like receptor-, tumor necrosis factor alpha-, and Mycobacterium tuberculosis-induced pro-inflammatory signals.
16107720 2005 CD26 mediates dissociation of Tollip and IRAK-1 from caveolin-1 and induces upregulation of CD86 on antigen-presenting cells.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
16052631 2005 TRAF4 acts as a silencer in TLR-mediated signaling through the association with TRAF6 and TRIF.
16024789 2005 A novel splice variant of interleukin-1 receptor (IL-1R)-associated kinase 1 plays a negative regulatory role in Toll/IL-1R-induced inflammatory signaling.
15829295 2005 Differential induction of apoptosis by LPS and taxol in monocytic cells.
15772651 2005 The DNA sequence of the human X chromosome.
15767370 2005 Interleukin-1 receptor-associated kinase-1 plays an essential role for Toll-like receptor (TLR)7- and TLR9-mediated interferon-{alpha} induction.
15691841 2005 Participation of Rip2 in lipopolysaccharide signaling is independent of its kinase activity.
15647277 2005 A central role for the Hsp90.Cdc37 molecular chaperone module in interleukin-1 receptor-associated-kinase-dependent signaling by toll-like receptors.
15523691 2005 Depressed tumor necrosis factor alpha and interleukin-12p40 production by peripheral blood mononuclear cells of gastric cancer patients: association with IL-1R-associated kinase-1 protein expression and disease stage.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15465816 2004 IRAK1 serves as a novel regulator essential for lipopolysaccharide-induced interleukin-10 gene expression.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15084582 2004 IRAK4 kinase activity is redundant for interleukin-1 (IL-1) receptor-associated kinase phosphorylation and IL-1 responsiveness.
15069085 2004 Dual receptors and distinct pathways mediate interleukin-1 receptor-associated kinase degradation in response to lipopolysaccharide. Involvement of CD14/TLR4, CR3, and phosphatidylinositol 3-kinase.
14752294 2004 Modulation of macrophage responsiveness to lipopolysaccharide by IRAK-1 manipulation.
14684752 2004 Regulation of interleukin receptor-associated kinase (IRAK) phosphorylation and signaling by iota protein kinase C.
14625308 2004 Sequential autophosphorylation steps in the interleukin-1 receptor-associated kinase-1 regulate its availability as an adapter in interleukin-1 signaling.
12925853 2003 SIGIRR, a negative regulator of Toll-like receptor-interleukin 1 receptor signaling.
12874243 2003 Pellino3, a novel member of the Pellino protein family, promotes activation of c-Jun and Elk-1 and may act as a scaffolding protein.
12860405 2003 Characterization of Pellino2, a substrate of IRAK1 and IRAK4.
12856330 2003 IRAK-dependent phosphorylation of Stat1 on serine 727 in response to interleukin-1 and effects on gene expression.
12724322 2003 Bruton's tyrosine kinase is a Toll/interleukin-1 receptor domain-binding protein that participates in nuclear factor kappaB activation by Toll-like receptor 4.
12721283 2003 TIRP, a novel Toll/interleukin-1 receptor (TIR) domain-containing adapter protein involved in TIR signaling.
12619925 2003 Association of a haplotype (196Phe/532Ser) in the interleukin-1-receptor-associated kinase (IRAK1) gene with low radial bone mineral density in two independent populations.
12566447 2003 Identification of TIFA as an adapter protein that links tumor necrosis factor receptor-associated factor 6 (TRAF6) to interleukin-1 (IL-1) receptor-associated kinase-1 (IRAK-1) in IL-1 receptor signaling.
12538665 2003 Inhibition of interleukin 1 receptor/Toll-like receptor signaling through the alternatively spliced, short form of MyD88 is due to its failure to recruit IRAK-4.
12496252 2003 Pellino 1 is required for interleukin-1 (IL-1)-mediated signaling through its interaction with the IL-1 receptor-associated kinase 4 (IRAK4)-IRAK-tumor necrosis factor receptor-associated factor 6 (TRAF6) complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391239 2002 Dysregulation of LPS-induced Toll-like receptor 4-MyD88 complex formation and IL-1 receptor-associated kinase 1 activation in endotoxin-tolerant cells.
12370331 2002 Cutting edge: mouse pellino-2 modulates IL-1 and lipopolysaccharide signaling.
12242293 2002 Interleukin-1 (IL-1) receptor-associated kinase-dependent IL-1-induced signaling complexes phosphorylate TAK1 and TAB2 at the plasma membrane and activate TAK1 in the cytosol.
12138165 2002 Identification of threonine 66 as a functionally critical residue of the interleukin-1 receptor-associated kinase.
12054681 2002 Identification and characterization of murine IRAK-M.
12034707 2002 Identification of interleukin 1 receptor-associated kinase as a conserved component in the p75-neurotrophin receptor activation of nuclear factor-kappa B.
11976320 2002 Inhibition of interleukin-1beta -induced NF-kappa B activation by calcium/calmodulin-dependent protein kinase kinase occurs through Akt activation associated with interleukin-1 receptor-associated kinase phosphorylation and uncoupling of MyD88.
11960013 2002 IRAK-4: a novel member of the IRAK family with the properties of an IRAK-kinase.
11953430 2002 Gram-negative flagellin-induced self-tolerance is associated with a block in interleukin-1 receptor-associated kinase release from toll-like receptor 5.
11937546 2002 Regulation of IL-1 receptor-associated kinases by lipopolysaccharide.
11828002 2002 The Fas-associated death domain protein suppresses activation of NF-kappa B by LPS and IL-1 beta.
11744690 2002 Ras participates in the activation of p38 MAPK by interleukin-1 by associating with IRAK, IRAK2, TRAF6, and TAK-1.
11701612 2001 Leukocyte integrin Mac-1 recruits toll/interleukin-1 receptor superfamily signaling intermediates to modulate NF-kappaB activity.
11518704 2001 IRAK-mediated translocation of TRAF6 and TAB2 in the interleukin-1-induced activation of NFkappa B.
11397809 2001 IRAK1b, a novel alternative splice variant of interleukin-1 receptor-associated kinase (IRAK), mediates interleukin-1 signaling and has prolonged stability.
11287640 2001 IL-1-induced NFkappa B and c-Jun N-terminal kinase (JNK) activation diverge at IL-1 receptor-associated kinase (IRAK).
11244088 2001 The atypical protein kinase C-interacting protein p62 is a scaffold for NF-kappaB activation by nerve growth factor.
11096118 2001 SIMPL is a tumor necrosis factor-specific regulator of nuclear factor-kappaB activity.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10899313 2000 Translocation of the interleukin-1 receptor-associated kinase-1 (IRAK-1) into the nucleus.
10854325 2000 Tollip, a new component of the IL-1RI pathway, links IRAK to the IL-1 receptor.
10723722 2000 Comparative sequence analysis of the MECP2-locus in human and mouse reveals new transcribed regions.
10465784 1999 ECSIT is an evolutionarily conserved intermediate in the Toll/IL-1 signal transduction pathway.
10395695 1999 Impaired cytokine signaling in mice lacking the IL-1 receptor-associated kinase.
10395652 1999 Signaling events induced by lipopolysaccharide-activated toll-like receptor 2.
10383454 1999 IRAK-M is a novel member of the Pelle/interleukin-1 receptor-associated kinase (IRAK) family.
10191251 1999 Overexpression of an enzymically inactive interleukin-1-receptor-associated kinase activates nuclear factor-kappaB.
10022904 1999 Activation of IkappaB kinase beta by protein kinase C isoforms.
9918122 The interleukin 1 receptor: ligand interactions and signal transduction.
9915784 1999 Association of the p75 neurotrophin receptor with TRAF6.
9625770 1998 The human toll signaling pathway: divergence of nuclear factor kappaB and JNK/SAPK activation upstream of tumor necrosis factor receptor-associated factor 6 (TRAF6).
9575168 1998 MyD88, an adapter protein involved in interleukin-1 signaling.
9430229 1997 MyD88: an adapter that recruits IRAK to the IL-1 receptor complex.
9374458 1997 IRAK (Pelle) family member IRAK-2 and MyD88 as proximal mediators of IL-1 signaling.
9371760 1997 Recruitment of IRAK to the interleukin 1 receptor complex requires interleukin 1 receptor accessory protein.
9252186 1997 A cytokine-responsive IkappaB kinase that activates the transcription factor NF-kappaB.
8837778 1996 TRAF6 is a signal transducer for interleukin-1.
8599092 1996 IRAK: a kinase associated with the interleukin-1 receptor.