Property Summary

NCBI Gene PubMed Count 28
PubMed Score 13.24
PubTator Score 18.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
chronic lymphocytic leukemia -1.980 1.2e-05
malignant mesothelioma 1.300 6.4e-07
astrocytic glioma -2.000 2.3e-03
ependymoma -1.700 4.8e-03
oligodendroglioma -1.500 4.8e-16
glioblastoma -2.100 9.9e-07
osteosarcoma -1.527 4.6e-07
medulloblastoma -2.400 1.1e-05
atypical teratoid / rhabdoid tumor -2.300 5.7e-10
medulloblastoma, large-cell -2.900 4.9e-05
primitive neuroectodermal tumor -1.500 5.2e-03
non-small cell lung cancer -1.164 1.9e-19
adult high grade glioma -2.200 2.0e-07
pilocytic astrocytoma -1.100 6.0e-05
subependymal giant cell astrocytoma -1.145 4.2e-02

Gene RIF (17)

PMID Text
26884337 both Arf6 activation through GluN2B-BRAG1 during early development and the transition from BRAG1- to BRAG2-dependent Arf6 signaling induced by the GluN2 subunit switch are critical for the development of mature glutamatergic synapses.
24902879 The EGFR-GEP100-Arf6 axis affected the prognosis of patients with primary lung adenocarcinoma.
24522833 Brag2 is essential for developmental and pathological angiogenesis by promoting endothelial cell sprouting through regulation of adhesion by beta1-integrin internalization and link for the first time the process of beta1-integrin endocytosis with angiogenesis.
24116160 Data show that co-overexpression of GEP100 and AMAP1 (ASAP1) correlates with rapidity of the local recurrence.
23747719 GEP100 regulates an Arf6/ERK/uPAR signaling cascade in EGF-induced breast cancer cell invasion.
22815487 BRAG2 acts at clathrin-coated pits to promote integrin internalization by activating Arf5 and suggest a previously unrecognized role for Arf5 in clathrin-mediated endocytosis of specific cargoes.
22701712 GEP100/Arf6 is required for epidermal growth factor-induced ERK/Rac1 signaling and cell migration in human hepatoma HepG2 cells.
22662237 GEP100 plays a significant role in pancreatic cancer invasion through regulating the expression of E-cadherin and the process of mesenchymal to epithelial transition (MET).
22613714 The PH domain and the interdomain linker of Brag2 may be targets for selectively regulating the activity of Brag2.
21966491 Cinical study indicates that co-overexpression of Her2 with GEP100 in primary lung adenocarcinomas of patients is correlated with the presence of their node-metastasis with a statistical significance.
21858086 Data suggest that GEP100-Arf6-AMAP1-cortactin pathway, activated by VEGFR2, appears to be common in angiogenesis and cancer invasion and metastasis, and provides their new therapeutic targets.
21795701 a novel phospholipid-regulated antiangiogenic signaling pathway whereby Sema3E activates Arf6 through Plexin-D1 and consequently controls integrin-mediated endothelial cell attachment to the extracellular matrix and migration.
20613766 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20601426 GEP100 functions in phagocytosis via its role in ARF6-dependent actin remodeling.
18084281 Results indicate that GEP100 links EGFR signalling to Arf6 activation to induce invasive activities of some breast cancer cells, and hence may contribute to their metastasis and malignancy.
16807291 Guanine nucleotide-exchange protein (GEP) 100/BRAG2 has an important role in the activation of ADP-ribosylation factor (ARF)6 for its functions in both E-cadherin recycling and actin remodeling.
16461286 Arf6 regulates both endocytosis and recycling of beta1 integrins and BRAG2 (IQSEC1) functions selectively to activate Arf6 during integrin internalization

AA Sequence

MWCLHCNSERTQSLLELELDSGVEGEAPSSETGTSLDSPSAYPQGPLVPGSSLSPDHYEHTSVGAYGLYS      1 - 70
GPPGQQQRTRRPKLQHSTSILRKQAEEEAIKRSRSLSESYELSSDLQDKQVEMLERKYGGRLVTRHAART     71 - 140
IQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFSFEGPEKVHSSYFEGKQVSVTNDGSQLGALV    141 - 210
SPECGDLSEPTTLKSPAPSSDFADAITELEDAFSRQVKSLAESIDDALNCRSLHTEEAPALDAARARDTE    211 - 280
PQTALHGMDHRKLDEMTASYSDVTLYIDEEELSPPLPLSQAGDRPSSTESDLRLRAGGAAPDYWALAHKE    281 - 350
DKADTDTSCRSTPSLERQEQRLRVEHLPLLTIEPPSDSSVDLSDRSERGSLKRQSAYERSLGGQQGSPKH    351 - 420
GPHSGAPKSLPREEPELRPRPPRPLDSHLAINGSANRQSKSESDYSDGDNDSINSTSNSNDTINCSSESS    421 - 490
SRDSLREQTLSKQTYHKEARNSWDSPAFSNDVIRKRHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVA    491 - 560
HFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEA    561 - 630
FSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREML    631 - 700
MGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDPNKPQK    701 - 770
LGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLI    771 - 840
NFNAPNPQDRKKFTDDLRESIAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGNGTLSRACLDDS    841 - 910
YASGEGLKRSALSSSLRDLSEAGKRGRRSSAGSLESNVEFQPFEPLQPSVLCS                     911 - 963
//

Text Mined References (35)

PMID Year Title
27265506 2016 ARF6 Is an Actionable Node that Orchestrates Oncogenic GNAQ Signaling in Uveal Melanoma.
26884337 2016 Subunit-selective N-Methyl-d-aspartate (NMDA) Receptor Signaling through Brefeldin A-resistant Arf Guanine Nucleotide Exchange Factors BRAG1 and BRAG2 during Synapse Maturation.
24902879 2014 Epidermal growth factor receptor-GEP100-Arf6 axis affects the prognosis of lung adenocarcinoma.
24522833 2014 Brag2 differentially regulates ?1- and ?3-integrin-dependent adhesion in endothelial cells and is involved in developmental and pathological angiogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24116160 2013 Co-overexpression of GEP100 and AMAP1 proteins correlates with rapid local recurrence after breast conservative therapy.
24058294 2013 Integrated conformational and lipid-sensing regulation of endosomal ArfGEF BRAG2.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23747719 2013 GEP100 regulates epidermal growth factor-induced MDA-MB-231 breast cancer cell invasion through the activation of Arf6/ERK/uPAR signaling pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22815487 2012 BRAG2/GEP100/IQSec1 interacts with clathrin and regulates ?5?1 integrin endocytosis through activation of ADP ribosylation factor 5 (Arf5).
22701712 2012 GEP100/Arf6 is required for epidermal growth factor-induced ERK/Rac1 signaling and cell migration in human hepatoma HepG2 cells.
22662237 2012 Down-regulation of GEP100 causes increase in E-cadherin levels and inhibits pancreatic cancer cell invasion.
22613714 2012 The pleckstrin homology (PH) domain of the Arf exchange factor Brag2 is an allosteric binding site.
21966491 2011 Engagement of overexpressed Her2 with GEP100 induces autonomous invasive activities and provides a biomarker for metastases of lung adenocarcinoma.
21858086 2011 GEP100-Arf6-AMAP1-cortactin pathway frequently used in cancer invasion is activated by VEGFR2 to promote angiogenesis.
21795701 2011 Phosphatidylinositol-4-phosphate 5-kinase and GEP100/Brag2 protein mediate antiangiogenic signaling by semaphorin 3E-plexin-D1 through Arf6 protein.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20613766 2010 Genome-wide association study to identify genetic variants present in Japanese patients harboring intracranial aneurysms.
20601426 2010 The guanine nucleotide exchange protein for ADP-ribosylation factor 6, ARF-GEP100/BRAG2, regulates phagocytosis of monocytic phagocytes in an ARF6-dependent process.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18084281 2008 GEP100 links epidermal growth factor receptor signalling to Arf6 activation to induce breast cancer invasion.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16807291 2006 GEP100/BRAG2: activator of ADP-ribosylation factor 6 for regulation of cell adhesion and actin cytoskeleton via E-cadherin and alpha-catenin.
16461286 2006 The Arf6 GEF GEP100/BRAG2 regulates cell adhesion by controlling endocytosis of beta1 integrins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11226253 2001 ARF-GEP(100), a guanine nucleotide-exchange protein for ADP-ribosylation factor 6.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.