Property Summary

NCBI Gene PubMed Count 36
PubMed Score 25.24
PubTator Score 20.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 2.700 7.2e-07
astrocytoma 1.100 7.4e-07
Astrocytoma, Pilocytic 1.400 9.4e-06
atypical teratoid / rhabdoid tumor 3.900 1.4e-07
Breast cancer -1.700 1.4e-04
Chronic Lymphocytic Leukemia -1.051 3.5e-03
colon cancer -1.300 9.8e-03
diabetes mellitus -1.200 3.1e-02
ependymoma 3.900 1.2e-17
esophageal adenocarcinoma 2.000 1.8e-02
glioblastoma 2.600 5.3e-10
group 3 medulloblastoma 2.200 2.7e-04
interstitial cystitis 1.500 1.6e-04
lung cancer -1.700 1.3e-03
lung carcinoma -1.900 1.5e-09
medulloblastoma, large-cell 1.600 1.7e-03
non-small cell lung cancer -1.249 3.2e-11
osteosarcoma -1.337 4.0e-02
pancreatic ductal adenocarcinoma liver m... -1.296 4.0e-03
primitive neuroectodermal tumor 3.100 1.1e-04
ulcerative colitis -1.400 1.5e-05

Gene RIF (21)

AA Sequence

MPHEELPSLQRPRYGSIVDDERLSAEEMDERRRQNIAYEYLCHLEEAKRWMEVCLVEELPPTTELEEGLR      1 - 70
NGVYLAKLAKFFAPKMVSEKKIYDVEQTRYKKSGLHFRHTDNTVQWLRAMESIGLPKIFYPETTDVYDRK     71 - 140
NIPRMIYCIHALSLYLFKLGIAPQIQDLLGKVDFTEEEISNMRKELEKYGIQMPSFSKIGGILANELSVD    141 - 210
EAALHAAVIAINEAVEKGIAEQTVVTLRNPNAVLTLVDDNLAPEYQKELWDAKKKKEENARLKNSCISEE    211 - 280
ERDAYEELLTQAEIQGNINKVNRQAAVDHINAVIPEGDPENTLLALKKPEAQLPAVYPFAAAMYQNELFN    281 - 350
LQKQNTMNYLAHEELLIAVEMLSAVALLNQALESNDLVSVQNQLRSPAIGLNNLDKAYVERYANTLLSVK    351 - 420
LEVLSQGQDNLSWNEIQNCIDMVNAQIQEENDRVVAVGYINEAIDEGNPLRTLETLLLPTANISDVDPAH    421 - 490
AQHYQDVLYHAKSQKLGDSESVSKVLWLDEIQQAVDDANVDKDRAKQWVTLVVDVNQCLEGKKSSDILSV    491 - 560
LKSSTSNANDIIPECADKYYDALVKAKELKSERVSSDGSWLKLNLHKKYDYYYNTDSKESSWVTPESCLY    561 - 630
KESWLTGKEIEDIIEEVTVGYIRENIWSASEELLLRFQATSSGPILREEFEARKSFLHEQEENVVKIQAF    631 - 700
WKGYKQRKEYMHRRQTFIDNTDSIVKIQSWFRMATARKSYLSRLQYFRDHNNEIVKIQSLLRANKARDDY    701 - 770
KTLVGSENPPLTVIRKFVYLLDQSDLDFQEELEVARLREEVVTKIRANQQLEKDLNLMDIKIGLLVKNRI    771 - 840
TLEDVISHSKKLNKKKGGEMEILNNTDNQGIKSLSKERRKTLETYQQLFYLLQTNPLYLAKLIFQMPQNK    841 - 910
STKFMDTVIFTLYNYASNQREEYLLLKLFKTALEEEIKSKVDQVQDIVTGNPTVIKMVVSFNRGARGQNT    911 - 980
LRQLLAPVVKEIIDDKSLIINTNPVEVYKAWVNQLETQTGEASKLPYDVTTEQALTYPEVKNKLEASIEN    981 - 1050
LRRVTDKVLNSIISSLDLLPYGLRYIAKVLKNSIHEKFPDATEDELLKIVGNLLYYRYMNPAIVAPDGFD   1051 - 1120
IIDMTAGGQINSDQRRNLGSVAKVLQHAASNKLFEGENEHLSSMNNYLSETYQEFRKYFKEACNVPEPEE   1121 - 1190
KFNMDKYTDLVTVSKPVIYISIEEIISTHSLLLEHQDAIAPEKNDLLSELLGSLGEVPTVESFLGEGAVD   1191 - 1260
PNDPNKANTLSQLSKTEISLVLTSKYDIEDGEAIDSRSLMIKTKKLIIDVIRNQPGNTLTEILETPATAQ   1261 - 1330
QEVDHATDMVSRAMIDSRTPEEMKHSQSMIEDAQLPLEQKKRKIQRNLRTLEQTGHVSSENKYQDILNEI   1331 - 1400
AKDIRNQRIYRKLRKAELAKLQQTLNALNKKAAFYEEQINYYDTYIKTCLDNLKRKNTRRSIKLDGKGEP   1401 - 1470
KGAKRAKPVKYTAAKLHEKGVLLDIDDLQTNQFKNVTFDIIATEDVGIFDVRSKFLGVEMEKVQLNIQDL   1471 - 1540
LQMQYEGVAVMKMFDKVKVNVNLLIYLLNKKFYGK                                      1541 - 1575
//

Text Mined References (46)

PMID Year Title