Property Summary

NCBI Gene PubMed Count 31
PubMed Score 24.13
PubTator Score 20.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
chronic lymphocytic leukemia -1.051 3.5e-03
esophageal adenocarcinoma 2.000 1.8e-02
astrocytoma 1.100 7.4e-07
glioblastoma 3.200 8.1e-08
osteosarcoma -1.337 4.0e-02
ependymoma 3.900 1.2e-17
medulloblastoma 2.200 8.6e-04
atypical teratoid / rhabdoid tumor 3.900 1.4e-07
medulloblastoma, large-cell 1.600 1.7e-03
primitive neuroectodermal tumor 3.100 1.1e-04
pancreatic ductal adenocarcinoma liver m... -1.296 4.0e-03
non-small cell lung cancer -1.249 3.2e-11
lung cancer -1.700 1.3e-03
colon cancer -1.300 9.8e-03
diabetes mellitus -1.200 3.1e-02
interstitial cystitis 1.500 1.6e-04
pediatric high grade glioma 2.700 8.9e-09
pilocytic astrocytoma 1.400 8.5e-06
lung carcinoma -1.900 1.5e-09
Breast cancer -1.700 1.4e-04
ulcerative colitis -1.400 1.5e-05

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (17)

PMID Text
26549344 Thus, these data identified IQGAP2 as a novel tumor suppressor for ovarian cancer to inhibit cell invasion through regulating Wnt/b-catenin signaling, and provided a new biomarker and potential therapeutic strategy for this disease.
26154927 we identified IQGAP2 as a human and zebrafish podocyte gene product that is downregulated in microarray data sets from kidney biopsies of human patients with focal segmental glomerulosclerosis and minimal change nephrotic syndrome.
26047140 Data show that IQ motif-containing GTPase-activating protein 2 (IQGAP2) expression is altered in colitis.
25722290 IQGAP1, IQGAP2, and IQGAP3 have diverse roles in vertebrate physiology, operating in the kidney, nervous system, cardiovascular system, pancreas, and lung. (Review)
25229330 Mammalian IQGAP proteins may play a role in cytokinesis by regulating the localization of key cytokinesis regulatory proteins to the contractile apparatus during mitosis.
24998570 Low IQGAP2 expression was associated with hepatocellular carcinoma.
22406297 observations strongly indicate that IQGAP2 is a surveillance type of tumour suppressor for prostate cancer
21299499 The first IQ-motifs from IQGAP2 and IQGAP3 form transient interactions with calmodulin in the absence of calcium.
20977743 increased IQGAP1 and/or decreased IQGAP2 contribute to the pathogenesis of human HCC.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20068591 The top-ranked SNP, rs457717 for association with age-related hearing impairment(P-value 3.55 x 10(-7)), was localised in an intron of the IQ motif-containing GTPase-activating-like protein (IQGAP2).
20068591 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17957782 silencing of IQGAP2 by promoter methylation may contribute to gastric cancer development.
12515716 The gene for the putative rac1/cdc42 effector protein IQGAP2 was found in the PAR gene cluster at 5q13, flanked by PAR1 & encompassing PAR3. It functions as a GTP-dependent effector protein in thrombin-induced platelet cytoskeletal reorganization.

AA Sequence

MPHEELPSLQRPRYGSIVDDERLSAEEMDERRRQNIAYEYLCHLEEAKRWMEVCLVEELPPTTELEEGLR      1 - 70
NGVYLAKLAKFFAPKMVSEKKIYDVEQTRYKKSGLHFRHTDNTVQWLRAMESIGLPKIFYPETTDVYDRK     71 - 140
NIPRMIYCIHALSLYLFKLGIAPQIQDLLGKVDFTEEEISNMRKELEKYGIQMPSFSKIGGILANELSVD    141 - 210
EAALHAAVIAINEAVEKGIAEQTVVTLRNPNAVLTLVDDNLAPEYQKELWDAKKKKEENARLKNSCISEE    211 - 280
ERDAYEELLTQAEIQGNINKVNRQAAVDHINAVIPEGDPENTLLALKKPEAQLPAVYPFAAAMYQNELFN    281 - 350
LQKQNTMNYLAHEELLIAVEMLSAVALLNQALESNDLVSVQNQLRSPAIGLNNLDKAYVERYANTLLSVK    351 - 420
LEVLSQGQDNLSWNEIQNCIDMVNAQIQEENDRVVAVGYINEAIDEGNPLRTLETLLLPTANISDVDPAH    421 - 490
AQHYQDVLYHAKSQKLGDSESVSKVLWLDEIQQAVDDANVDKDRAKQWVTLVVDVNQCLEGKKSSDILSV    491 - 560
LKSSTSNANDIIPECADKYYDALVKAKELKSERVSSDGSWLKLNLHKKYDYYYNTDSKESSWVTPESCLY    561 - 630
KESWLTGKEIEDIIEEVTVGYIRENIWSASEELLLRFQATSSGPILREEFEARKSFLHEQEENVVKIQAF    631 - 700
WKGYKQRKEYMHRRQTFIDNTDSIVKIQSWFRMATARKSYLSRLQYFRDHNNEIVKIQSLLRANKARDDY    701 - 770
KTLVGSENPPLTVIRKFVYLLDQSDLDFQEELEVARLREEVVTKIRANQQLEKDLNLMDIKIGLLVKNRI    771 - 840
TLEDVISHSKKLNKKKGGEMEILNNTDNQGIKSLSKERRKTLETYQQLFYLLQTNPLYLAKLIFQMPQNK    841 - 910
STKFMDTVIFTLYNYASNQREEYLLLKLFKTALEEEIKSKVDQVQDIVTGNPTVIKMVVSFNRGARGQNT    911 - 980
LRQLLAPVVKEIIDDKSLIINTNPVEVYKAWVNQLETQTGEASKLPYDVTTEQALTYPEVKNKLEASIEN    981 - 1050
LRRVTDKVLNSIISSLDLLPYGLRYIAKVLKNSIHEKFPDATEDELLKIVGNLLYYRYMNPAIVAPDGFD   1051 - 1120
IIDMTAGGQINSDQRRNLGSVAKVLQHAASNKLFEGENEHLSSMNNYLSETYQEFRKYFKEACNVPEPEE   1121 - 1190
KFNMDKYTDLVTVSKPVIYISIEEIISTHSLLLEHQDAIAPEKNDLLSELLGSLGEVPTVESFLGEGAVD   1191 - 1260
PNDPNKANTLSQLSKTEISLVLTSKYDIEDGEAIDSRSLMIKTKKLIIDVIRNQPGNTLTEILETPATAQ   1261 - 1330
QEVDHATDMVSRAMIDSRTPEEMKHSQSMIEDAQLPLEQKKRKIQRNLRTLEQTGHVSSENKYQDILNEI   1331 - 1400
AKDIRNQRIYRKLRKAELAKLQQTLNALNKKAAFYEEQINYYDTYIKTCLDNLKRKNTRRSIKLDGKGEP   1401 - 1470
KGAKRAKPVKYTAAKLHEKGVLLDIDDLQTNQFKNVTFDIIATEDVGIFDVRSKFLGVEMEKVQLNIQDL   1471 - 1540
LQMQYEGVAVMKMFDKVKVNVNLLIYLLNKKFYGK                                      1541 - 1575
//

Text Mined References (41)

PMID Year Title
26549344 2016 Epigenetic regulation of IQGAP2 promotes ovarian cancer progression via activating Wnt/?-catenin signaling.
26154927 2015 The Rho-GTPase binding protein IQGAP2 is required for the glomerular filtration barrier.
26047140 2015 IQ Motif-Containing GTPase-Activating Protein 2 (IQGAP2) Is a Novel Regulator of Colonic Inflammation in Mice.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25722290 2015 The biology of IQGAP proteins: beyond the cytoskeleton.
25229330 2014 Involvement of IQGAP family proteins in the regulation of mammalian cell cytokinesis.
24998570 2014 Differential expression of IQGAP1/2 in Hepatocellular carcinoma and its relationship with clinical outcomes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22493426 2012 IQGAP proteins reveal an atypical phosphoinositide (aPI) binding domain with a pseudo C2 domain fold.
22406297 2012 IQGAP2, A candidate tumour suppressor of prostate tumorigenesis.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21299499 2011 IQ-motif selectivity in human IQGAP2 and IQGAP3: binding of calmodulin and myosin essential light chain.
21269460 2011 Initial characterization of the human central proteome.
20977743 2010 IQGAP1 and IQGAP2 are reciprocally altered in hepatocellular carcinoma.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068591 2010 A genome-wide association study for age-related hearing impairment in the Saami.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
17957782 2008 IQGAP2 inactivation through aberrant promoter methylation and promotion of invasion in gastric cancer cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15621655 Cloning and characterization of a novel transcript variant of IQGAP2 in human testis.
15458922 2005 IQGAPs are differentially expressed and regulated in polarized gastric epithelial cells.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12515716 2003 IQGAP2 functions as a GTP-dependent effector protein in thrombin-induced platelet cytoskeletal reorganization.
12376551 2002 RhoG signals in parallel with Rac1 and Cdc42.
8756646 1996 The Ras GTPase-activating-protein-related human protein IQGAP2 harbors a potential actin binding domain and interacts with calmodulin and Rho family GTPases.
8702968 1996 Identification of a putative effector for Cdc42Hs with high sequence similarity to the RasGAP-related protein IQGAP1 and a Cdc42Hs binding partner with similarity to IQGAP2.