Property Summary

NCBI Gene PubMed Count 165
PubMed Score 205.97
PubTator Score 171.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Protein-protein Interaction (5)

Gene RIF (125)

PMID Text
27080863 Our data indicate a possible regulatory role for the multiple sclerosis-associated IKZF3 and IQGAP1 variants.
26473364 Our results identify OspB as a regulator of mTORC1 and mTORC1-dependent cell proliferation early during S. flexneri infection and establish a role for IQGAP1 in mTORC1 signaling
26398880 the present study is the first to provide evidence that miR-506 acts as a tumor suppressor, at least partially, by directly downregulating IQGAP1 in breast cancer cells.
26252773 the overexpression and interactions of IQGAP1 and beta-catenin contribute to hepatocellular carcinoma progression by promoting cell proliferation and migration.
26242911 Mechanistically, the N-terminal of SKAP binds to EB1, and its C terminus binds to IQGAP1 in migrating cells.
26195666 IQGAP1 critically mediates CXCR4 cell surface expression and signaling.
26078295 The clinical relevance of IQGAP1 as a tumor growth suppressor is supported by the finding that its expression is lower in bladder cancer compared with benign patient urothelium in multiple independent datasets.
26051604 IQGAP1 and its two isoforms regulate the actin-cytoskeleton alone and with their binding partners, Rac and Cdc42, thereby controlling diverse cellular processes, such as cell migration and adhesion. (Review)
26046126 IQGAP1 may directly interact with estrogen receptor alpha and serve as a signal integrator, mediating estrogen receptor alpha transcriptional activity, cell proliferation and cell invasion during the progression of thyroid cancer.
25928398 Depletion of IQGAP1 disrupts nuclear envelope localization and delays abscission timing.
25924234 Down-regulation of caveolin-1 or IQGAP1 in PC-3 cells reduced migration and invasion in vitro, and hypercholesterolemia-induced metastasis in vivo.
25733387 IQGAP1 as an essential regulator of the MAPK and Wnt/beta-catenin signaling pathways.
25722290 IQGAP1, IQGAP2, and IQGAP3 have diverse roles in vertebrate physiology, operating in the kidney, nervous system, cardiovascular system, pancreas, and lung. (Review)
25684348 These data indicated that TGF-beta inhibited IQGAP1 expression in lung fibroblasts via the NF-kappaB signaling pathway, presenting a potential novel therapeutic target for the treatment of idiopathic pulmonary fibrogenesis .
25675045 Increased IQGAP1 expression during the differentiation of cancer stem cell-like cells is involved in an aggressive cell behavior, which may contribute to metastasis of ovarian cancer.
25652011 Activated IQGAP1, as an intracellular partner of nephrin, is involved in actin cytoskeleton organization and functional regulation of podocytes.
25554515 ezrin appears to participate in recruiting IQGAP1 to the cell cortex thereby establishing a close connection between membrane-F-actin contacts and actin regulators that can be assembled by IQGAP1.
25436461 Results show that coexpression of IQGAP1 and Dvl in the cytoplasm and nucleus was correlated with the lymph nodal metastase and poor prognosis of non-small cell lung cancer.
25400725 IQGAP1 may regulate the phenotypic switch of venous smooth muscle cells by myocardin pathway, which is critical for the pathological progression of varicose vein.
25229330 Mammalian IQGAP proteins may play a role in cytokinesis by regulating the localization of key cytokinesis regulatory proteins to the contractile apparatus during mitosis.
25222038 Genetic variation within IQGAP1 is associated with cognitive function.
25175832 Study shows that miR-124a expression was downregulated in human glioma tissues, and its expression level was negatively correlated with the pathological grade. Also, the data shows that IQGAP1 is a direct target of miR-124a.
25044025 There was a positive correlation between DNAJB6 and IQGAP1 expression.
25022754 Studies show that IQGAP1 functions as a hub linking HGF-induced signaling to microtubules and actin remodeling via EB1-IQGAP1-cortactin interactions.
24998570 High IQGAP1 expression was associated with hepatocellular carcinoma.
24800852 Suppressing IQGAP1 expression not only obviously reduced the tumor cell growth.
24747073 results suggest a new role of IQGAP1, distinct form IQGAP2, in cell migration through up regulation of contractility and downregulation of adhesion sites potentially through calmodulin interaction.
24639526 RSPO-LGR4 not only induces the clearance of RNF43/ZNRF3 to increase Wnt receptor levels but also recruits IQGAP1 into the Wnt signaling complex.
24550401 IQGAP1 binds to ERalpha and modulates its transcriptional function
24488174 IQGAP1 expression in podocyte under high glucose media is modulated by the ERK1/2 pathway.
24462863 overexpression or knock-down of IQGAP1 affected the interaction between K-Ras and B-Raf, and IQGAP1 overexpression increased ERK1/2 phosphorylation in K-Ras dependent manner in PANC1 cells
24397597 Data indicate that quercetin inhibited the interaction between IQ motif-containing GTPase activating protein 1 (IQGAP1) and extracellular signal-regulated kinases ERK1/2 in RPMI8226 multiple myeloma cells.
24352566 PAK6 drives junction disassembly during HGF-driven cell-cell dissociation via an IQGAP1/E-cadherin complex that leads to the phosphorylation of beta-catenin and the disruption of cell-cell adhesions.
24278215 shows that IQGAP1 is essential to ECs alignment under shear stress and that AJ remodeling represents one of the mechanisms involved
24196961 IQGAP1 interacts with human importin-beta5 in HEK 293T cells.
24103286 Overexpression of IQGAP1 may play an important role in pancreatic cancer occurrence and progression.
24101133 IQGAP1 plays an important role in the cell proliferation ofmultiple myelomavia the MAP kinase (ERK) pathway.
23982733 IQGAP1 is a novel phosphatidylinositol 4,5 bisphosphate effector in regulation of directional cell migration.
23807500 these results suggest that a labile pool of IQGAP1 at intercellular junctions disassembles adherens junctions and thus impairs endothelial cell-cell adhesion.
23788642 results suggest that IQGAP1 may play an important role in the MEK-ERK-Nrf2 signaling pathway
23637409 Host IQGAP1 and Ebola virus VP40 interactions facilitate virus-like particle egress.
23603816 IQGAP1 has an essential role in RAS-driven tumorigenesis in mouse and human tissue
23577172 IQGAP1 functions as a modulator in the canonical Wnt signaling pathway
23454766 IQGAP1 in the tumor microenvironment suppresses TGFBR2 and TGF-beta dependent myofibroblastic differentiation to constrain tumor growth.
23405264 High IQGAP1 expression is associated with invasive breast tumors.
23145020 RhoC stimulates the proliferation of gastric cancer cells through recruiting IQGAP1 as an effector.
23125841 Tandem affinity purification and mass spectrometry analysis identify IQ motif containing GTPase activating protein 1 (IQGAP1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23071436 it is proposed that the targeting of IQGAP1 by 3O-C(12)-HSL can trigger essential changes in the cytoskeleton network and be an essential component in bacterial--human cell communication
22992742 Data show that the IQ-motif-containing GTPase-activating protein IQGAP1 interacts directly with GTP-bound, prenylated RhoA and RhoC, but not with RhoB.
22964981 This finding has new implications for involvement of IQGAP1 in cell polarization and migration events and potentially in cell cycle-associated nuclear envelope assembly/disassembly.
22944912 A calcium-dependent interaction between calmodulin and the calponin homology domain of human IQGAP1
22793650 Treating the cells with calcium showed the translocation of IQGAP1/Nrf2 complex into the nucleus.
22662192 our results suggest that IQGAP1, through its interaction with components of SD and cytoskeletal proteins, is involved in podocyte barrier properties.
22634185 The IQGAP1 was required for hyaluronan- but not for platelet-derived growth factor (PDGF)-BB-induced cell migration, and was required for both hyaluronan- and PDGF-BB-mediated fibroblast proliferation.
22573807 our data suggest that IQGAP1 acts as a dual negative regulator in T cells, limiting both TCR-mediated activation kinetics and F-actin dynamics via distinct mechanisms.
22519731 Binding of OmpA to Ecgp96 signals IQGAP1 to detach beta-catenin from adherens junctions and IQGAP1/beta-catenin bound actin translocates to the site of Escherichia coli K1 attachment to promote bacterial invasion.
22483753 these results showed an unidentified relationship between Aurora-A and IQGAP1, and provided a new insight into the molecular mechanism by which IQGAP1 played a regulatory role in cancer.
22328503 IQGAP1 modulates mTORC1-S6K1-->Akt1 signaling to control cell proliferation.
22182509 IQGAP1 is a scaffold protein with recently expanding repertoire of cellular activities in which it participates. (Review)
22080369 IQGAP1 plays a dynamic role via direct interactions with calmodulin in a Ca(2+)-dependent or -independent manner
21885850 Angiopoietin-1 requires IQ domain GTPase-activating protein 1 to activate Rac1 and promote endothelial barrier defense.
21876773 IQGAP1 is a novel essential component of the CXCR2 "chemosynapse".
21750196 Data show that protein 4.1R is necessary for the localization of IQGAP1 to the leading edge of cells migrating into a wound, whereas IQGAP1 is not required for protein 4.1R localization.
21730051 IQGAP1 is a calmodulin-regulated barbed end capper of actin filaments with a role in cell migration
21724847 IQGAP1 protein binds human epidermal growth factor receptor 2 (HER2) and modulates trastuzumab resistance.
21681737 regulates cytoskeletal organization and granule polarization in NK cells
21640080 IQGAP1 protein, an actin cytoskeleton modifier acts as a binding partner with SMG-9 and this binding is regulated by phosphorylation of SMG-9 at Tyr-41.
21621326 Tbeta(4) increases migration of colon cancer cells via activating Rac1 by elevating IQGAP1/ILK complexes
21537845 The knockdown of IQGAP1 expression by siRNA blocked the migrationstimulating activity of RhoC.
21318219 single nucleotide polymorphisms in the miR-124 binding site within the IQ motif containing GTPase activating protein 1 gene confer differential predisposition to breast cancer
21295032 Data that support a role for IQGAP1 in infectious disease via its ability to regulate the actin cytoskeleton, is reviewed.
21177863 S100P is a novel Ca(2+)-dependent regulator of IQGAP1 that can down-regulate the function of IQGAP1 as a signaling intermediate by direct interaction
20977743 increased IQGAP1 and/or decreased IQGAP2 contribute to the pathogenesis of human HCC.
20959410 IQGAP1, through genetic copy gain, plays an important role in the invasiveness of thyroid cancer and may represent a novel prognostic marker and therapeutic target for this cancer.
20883816 IQGAP1 translocates into the nucleus in late G1/early S phase to stimulate DNA replication and progression of the cell cycle.
20875083 Data show that the IQ motif-containing Ras GTPase-activating-like protein 1 (IQGAP1) can associate with RNase L, and that phosphorylation occurs on the IQGAP1, and works as a regulator in apoptosis.
20644981 Solved the NMR structure of the actin binding domain of human IQGAP1.
20530982 IQGAP1 is a scaffold that facilitates mTOR and Akt interaction.
20127691 Quantitative proteomic analysis showed that IQGAP1 was 0.53-fold down-regulated under 10 microg/mL HNK exposure for 24 h on HepG2 cells.
20017185 results indicate that endothelial IQGAP1 tethers microtubules to interendothelial junctions and participates in junction remodeling during lymphocyte transendothelial migration.
19856315 IQGAP1 plays a critical role in colon cancer cell invasion; therefore diffuse and high expression of IQGAP1 predicts poor prognosis in patients with colorectal carcinoma.
19454477 A model where IQGAP1 serves as a phosphorylation-sensitive conformation switch to regulate the coupling of cell growth and division through a novel CDC42-mTOR pathway.
19366706 These results demonstrate a role of PLD in hyperoxia-mediated IQGAP1 activation through Rac1 in tyrosine phosphorylation of Src and cortactin, as well as in p47(phox) translocation and reactive oxygen species formation in human lung endothelial cells.
19321438 The crystal structure of the isolated IQGAP1 GAP-related domain, is reported.
19155310 Data suggest that ARF6-mediated Rac1 activation is essential for glioma cell invasion via a signaling pathway that requires IQGAP1.
19134119 We identified IQGAP1 as a host cell interaction partner of the novel effector protein Ibe of EPEC and EHEC strains. [IQGAP1]
19036171 IQGAP1 expression level seemed to be closely associated with the enhanced invasion and migration in ovarian cancer cell lines.
18809683 IQGAP1, Ca(2+), and calmodulin are a novel signaling complex regulating actin pedestal formation by EPEC
18587628 Only the first IQ motif of IQGAP1 interacts with MYL6B. The first and second IQ motifs of IQGAP1 interact with S100B in the presence of calcium ions.
18575779 IQGAP1 promotes cell proliferation and phosphorylation of IQGAP1 is involved in the process of wound closure in bronchial epithelial cells.
18567582 the scaffold protein IQGAP1 couples Ca(2+) and calmodulin signaling to B-Raf function
18541705 The exocyst subunits Sec3 and Sec8 interact with the polarity protein IQGAP1 and that this interaction is triggered by active Cdc42 and RhoA, which are essential for matrix degradation.
17981797 IQGAP1 enhances mammary tumorigenesis, suggesting that it may be a target for therapeutic intervention.
17853893 that ALIX and TSG101/ESCRT-I also bind a series of proteins involved in cytokinesis, including CEP55, CD2AP, ROCK1, and IQGAP1.
17693642 IQGAP1 regulates Salmonella invasion through interactions with actin, Rac1, and Cdc42
17620407 DIA1 and IQGAP1 interact in cell migration and phagocytic cup formation.
17563371 IQGAP1 modulates activation of B-Raf.
17544257 These data suggest that IQGAP1 serves as a junction to integrate multiple signalling molecules to facilitate cell migration.
17517894 IQGAP1 may link the calmodulin and Rap1 signaling pathways
17255093 in motile cells beta-catenin is recruited by IQGAP1 and N-cadherin to active membrane ruffles, wherein beta-catenin mediates the internalization and possible recycling of the membrane-associated proteins N-cadherin and APC
17085436 signal-induced relief of the autoinhibited fold of IQGAP1 allows activation of N-WASP to stimulate Arp2/3-dependent actin assembly
16622255 IQGAP1 represents a potential target for the design of new organ preservation strategies and prevention of Ischemia-reperfusion injury to improve transplantation outcome.
16387427 Findings suggest the involvement of IQGAP1 in the progression and spread of ovarian adenocarcinomas.
16380380 PTPmu may regulate Rho-GTPase-dependent functions of IQGAP1
16245300 We therefore propose that PP2A plays a crucial role in the maintenance of cell-cell adhesion through recruitment of IQGAP1 to the Rac-bound E-cadherin-catenins complex.
16190873 GluR4 may regulate its synaptic targeting through phosphorylation-dependent interactions with alpha-Actinin-1 and IQGAP1
16179592 IQGAP1 may function to link Nox2 to actin at the leading edge, thereby facilitating reactive oxygen species production at the site of injury, which may contribute to endothelial cell migration
16135787 IQGAP1 interacts directly with MEK1 and MEK2 kinases.
16105843 a specific sequence of IQGAP1 is necessary for its oligomerization; self-association is required for the normal cellular function of IQGAP1
15695813 Data show that IQGAP1 is phosphorylated at multiple sites in intact cells and that phosphorylation of IQGAP1 will alter its ability to regulate the cytoskeleton of neuronal cells.
15634346 IQGAP1 is expressed in podocytes at significant levels, and could be found at the immediate vicinity of the slit diaphragm
15521075 We therefore propose that PP2A, especially PP2A-A, functions to maintain F-actin assembly to which beta1 integrin is anchored by recruitment of IQGAP1 to Rac-beta1 integrin.
15355962 IQGAP1 might serve as an effector or sequester nucleotide-free Cdc42 to prevent signaling
15252131 differential requirement for efficient GTP hydrolysis by the Sar1p GTPase in export of cargo from the endoplasmic reticulum
15217908 IQGAP1 functions as a VEGFR2-associated scaffold protein to organize ROS-dependent VEGF signaling, thus promoting EC migration & proliferation, which may contribute to repair & maintenance of the functional integrity of established blood vessels.
14970219 IQGAP1 binds ERK2 and modulates its activity
14699063 Rac1 enhances the accumulation of actin filaments, E-cadherin, and beta-catenin by acting on IQGAP1.
12938160 Data suggest that cyclic AMP/protein kinase A may be coupled with calcium/calmodulin and guanosine triphosphatases through an IQGAP1/AKAP79 complex.
12900413 IQGAP1 has a fundamental role in cell motility and invasion
12745076 Identification and characterization of the Cdc42-binding site of IQGAP1.
12446675 interaction of calmodulin with IQ motifs
12377780 IQGAP1 is a potential target protein of S100B during processes of dynamic rearrangement of cell membrane morphology
11948177 IQGAP1 has a crucial role in transducing Cdc42 signaling to the cytoskeleton
11809768 The mechanism for regulation of the F-actin binding activity of IQGAP1 by calcium/calmodulin
11734550 IQGAP1 enhances the function of beta-catenin in the nucleus and that calmodulin regulates this stimulation

AA Sequence

MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGEDLPPTTELEE      1 - 70
GLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWLNAMDEIGLPKIFYPETTDIY     71 - 140
DRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEEEINNMKTELEKYGIQMPAFSKIGGILANEL    141 - 210
SVDEAALHAAVIAINEAIDRRIPADTFAALKNPNAMLVNLEEPLASTYQDILYQAKQDKMTNAKNRTENS    211 - 280
ERERDVYEELLTQAEIQGNINKVNTFSALANIDLALEQGDALALFRALQSPALGLRGLQQQNSDWYLKQL    281 - 350
LSDKQQKRQSGQTDPLQKEELQSGVDAANSAAQQYQRRLAAVALINAAIQKGVAEKTVLELMNPEAQLPQ    351 - 420
VYPFAADLYQKELATLQRQSPEHNLTHPELSVAVEMLSSVALINRALESGDVNTVWKQLSSSVTGLTNIE    421 - 490
EENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQA    491 - 560
LQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAI    561 - 630
NEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNL    631 - 700
ETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMN    701 - 770
FLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDII    771 - 840
KIQAFIRANKARDDYKTLINAEDPPMVVVRKFVHLLDQSDQDFQEELDLMKMREEVITLIRSNQQLENDL    841 - 910
NLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKALSKEKREKLEAYQHLFYLLQ    911 - 980
TNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEYLLLRLFKTALQEEIKSKVDQIQEIVTGNPT    981 - 1050
VIKMVVSFNRGARGQNALRQILAPVVKEIMDDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQ   1051 - 1120
ALAHEEVKTRLDSSIRNMRAVTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNL   1121 - 1190
LYYRYMNPAIVAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQ   1191 - 1260
KFRRFFQTACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEHNDPIHELLDD   1261 - 1330
LGEVPTIESLIGESSGNLNDPNKEALAKTEVSLTLTNKFDVPGDENAEMDARTILLNTKRLIVDVIRFQP   1331 - 1400
GETLTEILETPATSEQEAEHQRAMQRRAIRDAKTPDKMKKSKSVKEDSNLTLQEKKEKIQTGLKKLTELG   1401 - 1470
TVDPKNKYQELINDIARDIRNQRRYRQRRKAELVKLQQTYAALNSKATFYGEQVDYYKSYIKTCLDNLAS   1471 - 1540
KGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGV   1541 - 1610
QMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK                          1611 - 1657
//

Text Mined References (175)

PMID Year Title
27080863 2016 Allelic imbalance of multiple sclerosis susceptibility genes IKZF3 and IQGAP1 in human peripheral blood.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26473364 2015 Shigella Effector OspB Activates mTORC1 in a Manner That Depends on IQGAP1 and Promotes Cell Proliferation.
26398880 2015 miR-506 regulates breast cancer cell metastasis by targeting IQGAP1.
26252773 2015 The Overexpression of IQGAP1 and ?-Catenin Is Associated with Tumor Progression in Hepatocellular Carcinoma In Vitro and In Vivo.
26242911 2015 Signaling Scaffold Protein IQGAP1 Interacts with Microtubule Plus-end Tracking Protein SKAP and Links Dynamic Microtubule Plus-end to Steer Cell Migration.
26195666 2015 IQGAP1 promotes CXCR4 chemokine receptor function and trafficking via EEA-1+ endosomes.
26078295 2015 Patient Mutation Directed shRNA Screen Uncovers Novel Bladder Tumor Growth Suppressors.
26051604 2015 IQGAPs as Key Regulators of Actin-cytoskeleton Dynamics.
26046126 2015 IQGAP1 modulates the proliferation and invasion of thyroid cancer cells in response to estrogen.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25928398 2015 IQGAP1 is associated with nuclear envelope reformation and completion of abscission.
25924234 2015 Diet-induced hypercholesterolemia promotes androgen-independent prostate cancer metastasis via IQGAP1 and caveolin-1.
25733387 2015 IQGAP1: insights into the function of a molecular puppeteer.
25722290 2015 The biology of IQGAP proteins: beyond the cytoskeleton.
25684348 2015 Transforming growth factor-? inhibits IQ motif containing guanosine triphosphatase activating protein 1 expression in lung fibroblasts via the nuclear factor-?B signaling pathway.
25675045 2015 IQGAP1 Is Involved in Enhanced Aggressive Behavior of Epithelial Ovarian Cancer Stem Cell-Like Cells During Differentiation.
25652011 2015 IQGAP1 regulates actin cytoskeleton organization in podocytes through interaction with nephrin.
25554515 2015 Ezrin interacts with the scaffold protein IQGAP1 and affects its cortical localization.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25436461 2014 Coexpression of IQ-domain GTPase-activating protein 1 (IQGAP1) and Dishevelled (Dvl) is correlated with poor prognosis in non-small cell lung cancer.
25400725 2014 IQGAP1 promotes the phenotypic switch of vascular smooth muscle by myocardin pathway: a potential target for varicose vein.
25229330 2014 Involvement of IQGAP family proteins in the regulation of mammalian cell cytokinesis.
25222038 2014 A functional MiR-124 binding-site polymorphism in IQGAP1 affects human cognitive performance.
25175832 2014 miR-124a restoration inhibits glioma cell proliferation and invasion by suppressing IQGAP1 and ?-catenin.
25074804 2014 Coronin-1C and RCC2 guide mesenchymal migration by trafficking Rac1 and controlling GEF exposure.
25044025 2015 Overexpression of DNAJB6 promotes colorectal cancer cell invasion through an IQGAP1/ERK-dependent signaling pathway.
25022754 2014 IQGAP1 regulates endothelial barrier function via EB1-cortactin cross talk.
24998570 2014 Differential expression of IQGAP1/2 in Hepatocellular carcinoma and its relationship with clinical outcomes.
24800852 2014 Targeted knockdown of IQGAP1 inhibits the progression of esophageal squamous cell carcinoma in vitro and in vivo.
24747073 2014 A novel role for IQGAP1 protein in cell motility through cell retraction.
24639526 2014 RSPO-LGR4 functions via IQGAP1 to potentiate Wnt signaling.
24550401 2014 IQGAP1 binds to estrogen receptor-? and modulates its function.
24488174 2014 The Ras GTPase-activating-like protein IQGAP1 is downregulated in human diabetic nephropathy and associated with ERK1/2 pathway activation.
24462863 2014 IQGAP1 selectively interacts with K-Ras but not with H-Ras and modulates K-Ras function.
24397597 2014 Quercetin suppresses the proliferation of multiple myeloma cells by down-regulating IQ motif-containing GTPase activating protein 1 expression and extracellular signal-regulated kinase activation.
24352566 2014 A PAK6-IQGAP1 complex promotes disassembly of cell-cell adhesions.
24278215 2013 IQ domain GTPase-activating protein 1 is involved in shear stress-induced progenitor-derived endothelial cell alignment.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24196961 2013 IQGAP1 protein regulates nuclear localization of ?-catenin via importin-?5 protein in Wnt signaling.
24103286 2013 Overexpression of IQGAP1 in human pancreatic cancer.
24101133 2013 IQGAP1 plays an important role in the cell proliferation of multiple myeloma via the MAP kinase (ERK) pathway.
23982733 2013 IQGAP1 is a novel phosphatidylinositol 4,5 bisphosphate effector in regulation of directional cell migration.
23807500 2013 A labile pool of IQGAP1 disassembles endothelial adherens junctions.
23788642 2013 The Ras GTPase-activating-like protein IQGAP1 mediates Nrf2 protein activation via the mitogen-activated protein kinase/extracellular signal-regulated kinase (ERK) kinase (MEK)-ERK pathway.
23637409 2013 Host IQGAP1 and Ebola virus VP40 interactions facilitate virus-like particle egress.
23603816 2013 IQGAP1 scaffold-kinase interaction blockade selectively targets RAS-MAP kinase-driven tumors.
23577172 2013 IQGAP1 functions as a modulator of dishevelled nuclear localization in Wnt signaling.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23454766 2013 IQGAP1 suppresses T?RII-mediated myofibroblastic activation and metastatic growth in liver.
23405264 2013 ?-Arrestin2 regulates lysophosphatidic acid-induced human breast tumor cell migration and invasion via Rap1 and IQGAP1.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23145020 2012 RhoC regulates the proliferation of gastric cancer cells through interaction with IQGAP1.
23071436 2012 The Pseudomonas aeruginosa N-acylhomoserine lactone quorum sensing molecules target IQGAP1 and modulate epithelial cell migration.
22992742 2012 Rho isoform-specific interaction with IQGAP1 promotes breast cancer cell proliferation and migration.
22964981 The scaffolding protein IQGAP1 co-localizes with actin at the cytoplasmic face of the nuclear envelope: implications for cytoskeletal regulation.
22944912 2012 A calcium-dependent interaction between calmodulin and the calponin homology domain of human IQGAP1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22793650 2013 Identification and functional studies of a new Nrf2 partner IQGAP1: a critical role in the stability and transactivation of Nrf2.
22662192 2012 IQGAP1 interacts with components of the slit diaphragm complex in podocytes and is involved in podocyte migration and permeability in vitro.
22634185 2012 IQGAP1 regulates hyaluronan-mediated fibroblast motility and proliferation.
22573807 2012 The cytoskeletal adaptor protein IQGAP1 regulates TCR-mediated signaling and filamentous actin dynamics.
22519731 2012 IQGAP1 mediates the disruption of adherens junctions to promote Escherichia coli K1 invasion of brain endothelial cells.
22493426 2012 IQGAP proteins reveal an atypical phosphoinositide (aPI) binding domain with a pseudo C2 domain fold.
22483753 2012 IQGAP1 interacts with Aurora-A and enhances its stability and its role in cancer.
22328503 2012 A conserved role of IQGAP1 in regulating TOR complex 1.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22182509 2012 IQGAP1 and its binding proteins control diverse biological functions.
22080369 2011 Characterization of novel calmodulin binding domains within IQ motifs of IQGAP1.
21885850 2011 Angiopoietin-1 requires IQ domain GTPase-activating protein 1 to activate Rac1 and promote endothelial barrier defense.
21876773 2011 IQGAP1 is a novel CXCR2-interacting protein and essential component of the "chemosynapse".
21750196 2011 Protein 4.1R regulates cell migration and IQGAP1 recruitment to the leading edge.
21730051 2011 The IQGAP1 protein is a calmodulin-regulated barbed end capper of actin filaments: possible implications in its function in cell migration.
21724847 2011 IQGAP1 protein binds human epidermal growth factor receptor 2 (HER2) and modulates trastuzumab resistance.
21681737 2011 IQGAP1 involvement in MTOC and granule polarization in NK-cell cytotoxicity.
21640080 2011 Role of a tyrosine phosphorylation of SMG-9 in binding of SMG-9 to IQGAP and the NMD complex.
21621326 2011 Thymosin beta 4 induces colon cancer cell migration and clinical metastasis via enhancing ILK/IQGAP1/Rac1 signal transduction pathway.
21537845 RhoC protein stimulates migration of gastric cancer cells through interaction with scaffold protein IQGAP1.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21349850 2011 MAPK scaffold IQGAP1 binds the EGF receptor and modulates its activation.
21318219 2011 Genetic variants at the miR-124 binding site on the cytoskeleton-organizing IQGAP1 gene confer differential predisposition to breast cancer.
21295032 2011 IQGAP1 in microbial pathogenesis: Targeting the actin cytoskeleton.
21269460 2011 Initial characterization of the human central proteome.
21177863 2011 S100P is a novel interaction partner and regulator of IQGAP1.
20977743 2010 IQGAP1 and IQGAP2 are reciprocally altered in hepatocellular carcinoma.
20959410 2010 IQGAP1 plays an important role in the invasiveness of thyroid cancer.
20883816 2011 IQGAP1 translocates to the nucleus in early S-phase and contributes to cell cycle progression after DNA replication arrest.
20875083 2010 Association of RNase L with a Ras GTPase-activating-like protein IQGAP1 in mediating the apoptosis of a human cancer cell-line.
20644981 2010 NMR structure of the calponin homology domain of human IQGAP1 and its implications for the actin recognition mode.
20530982 2010 IQGAP1 is overexpressed in hepatocellular carcinoma and promotes cell proliferation by Akt activation.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20127691 2010 Honokiol inhibits HepG2 migration via down-regulation of IQGAP1 expression discovered by a quantitative pharmaceutical proteomic analysis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20017185 2010 Endothelial IQGAP1 regulates efficient lymphocyte transendothelial migration.
19856315 2010 Overexpression of IQGAP1 in advanced colorectal cancer correlates with poor prognosis-critical role in tumor invasion.
19454477 2009 IQGAP1 regulates cell proliferation through a novel CDC42-mTOR pathway.
19366706 2009 Phospholipase D-mediated activation of IQGAP1 through Rac1 regulates hyperoxia-induced p47phox translocation and reactive oxygen species generation in lung endothelial cells.
19321438 2009 Crystal structure of the GTPase-activating protein-related domain from IQGAP1.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19155310 2009 ADP-ribosylation factor 6 regulates glioma cell invasion through the IQ-domain GTPase-activating protein 1-Rac1-mediated pathway.
19134119 2009 Identification and characterization of Ibe, a novel type III effector protein of A/E pathogens targeting human IQGAP1.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19036171 2008 Silencing of IQGAP1 by shRNA inhibits the invasion of ovarian carcinoma HO-8910PM cells in vitro.
18809683 2008 Actin pedestal formation by enteropathogenic Escherichia coli is regulated by IQGAP1, calcium, and calmodulin.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18642328 2008 Increased PAK6 expression in prostate cancer and identification of PAK6 associated proteins.
18587628 2008 IQ motif selectivity in human IQGAP1: binding of myosin essential light chain and S100B.
18575779 2008 IQGAP1 promotes cell proliferation and is involved in a phosphorylation-dependent manner in wound closure of bronchial epithelial cells.
18567582 2008 IQGAP1 integrates Ca2+/calmodulin and B-Raf signaling.
18541705 2008 The interaction of IQGAP1 with the exocyst complex is required for tumor cell invasion downstream of Cdc42 and RhoA.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17981797 2008 IQGAP1 stimulates proliferation and enhances tumorigenesis of human breast epithelial cells.
17853893 2007 Human ESCRT and ALIX proteins interact with proteins of the midbody and function in cytokinesis.
17693642 2007 IQGAP1 regulates Salmonella invasion through interactions with actin, Rac1, and Cdc42.
17620407 2007 Dia1 and IQGAP1 interact in cell migration and phagocytic cup formation.
17563371 2007 IQGAP1 modulates activation of B-Raf.
17544257 2007 Multiple proteins mediate IQGAP1-stimulated cell migration.
17517894 2007 IQGAP1 binds Rap1 and modulates its activity.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17255093 2007 IQ-domain GTPase-activating protein 1 regulates beta-catenin at membrane ruffles and its role in macropinocytosis of N-cadherin and adenomatous polyposis coli.
17085436 2007 IQGAP1 stimulates actin assembly through the N-WASP-Arp2/3 pathway.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16622255 2006 Proteomic analysis of ischemia-reperfusion injury upon human liver transplantation reveals the protective role of IQGAP1.
16387427 2006 Overexpression and diffuse expression pattern of IQGAP1 at invasion fronts are independent prognostic parameters in ovarian carcinomas.
16380380 2006 The receptor protein-tyrosine phosphatase PTPmu interacts with IQGAP1.
16245300 2006 Involvement of protein phosphatase 2A in the maintenance of E-cadherin-mediated cell-cell adhesion through recruitment of IQGAP1.
16190873 2005 Phosphorylation-dependent interactions of alpha-Actinin-1/IQGAP1 with the AMPA receptor subunit GluR4.
16179592 2005 IQGAP1 regulates reactive oxygen species-dependent endothelial cell migration through interacting with Nox2.
16135787 2005 IQGAP1 is a scaffold for mitogen-activated protein kinase signaling.
16105843 2005 Self-association of IQGAP1: characterization and functional sequelae.
15695813 2005 IQGAP1 promotes neurite outgrowth in a phosphorylation-dependent manner.
15634346 2005 Characterization of the interactions of the nephrin intracellular domain.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15572129 2004 Interaction with IQGAP1 links APC to Rac1, Cdc42, and actin filaments during cell polarization and migration.
15572120 2004 A new cytoskeletal connection for APC: linked to actin through IQGAP.
15521075 2005 Requirement of protein phosphatase 2A for recruitment of IQGAP1 to Rac-bound beta1 integrin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15389538 2005 Interactions among IQGAP1, Cdc42, and the cadherin/catenin protein complex regulate Sertoli-germ cell adherens junction dynamics in the testis.
15355962 2004 Phosphorylation of IQGAP1 modulates its binding to Cdc42, revealing a new type of rho-GTPase regulator.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15263019 2004 Endocytosis of E-cadherin regulated by Rac and Cdc42 small G proteins through IQGAP1 and actin filaments.
15252131 2004 Differential effects of a GTP-restricted mutant of Sar1p on segregation of cargo during export from the endoplasmic reticulum.
15217908 2004 IQGAP1, a novel vascular endothelial growth factor receptor binding protein, is involved in reactive oxygen species--dependent endothelial migration and proliferation.
15166316 2004 Dissection of the mammalian midbody proteome reveals conserved cytokinesis mechanisms.
15121898 2004 The composition of Staufen-containing RNA granules from human cells indicates their role in the regulated transport and translation of messenger RNAs.
15081409 2004 Calcium negatively modulates calmodulin interaction with IQGAP1.
14970219 2004 IQGAP1 binds ERK2 and modulates its activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699063 2004 Positive role of IQGAP1, an effector of Rac1, in actin-meshwork formation at sites of cell-cell contact.
12938160 2003 Identification of an IQGAP1/AKAP79 complex in beta-cells.
12900413 2003 IQGAP1 promotes cell motility and invasion.
12745076 2003 Identification and characterization of the Cdc42-binding site of IQGAP1.
12603848 2003 RasGAP-like protein IQGAP1 is expressed by human keratinocytes and recognized by autoantibodies in association with bullous skin disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446675 2003 Elucidation of the interaction of calmodulin with the IQ motifs of IQGAP1.
12377780 2002 The zinc- and calcium-binding S100B interacts and co-localizes with IQGAP1 during dynamic rearrangement of cell membranes.
11948177 2002 IQGAP1 is a component of Cdc42 signaling to the cytoskeleton.
11790459 2002 Immunohistochemical analysis of IQGAP1 expression in human colorectal carcinomas: its overexpression in carcinomas and association with invasion fronts.
11734550 2002 IQGAP1-mediated stimulation of transcriptional co-activation by beta-catenin is modulated by calmodulin.
11289714 2001 IQGAP1, a negative regulator of cell-cell adhesion, is upregulated by gene amplification at 15q26 in gastric cancer cell lines HSC39 and 40A.
10793131 2000 Identification of a novel member of the chloride intracellular channel gene family (CLIC5) that associates with the actin cytoskeleton of placental microvilli.
10608854 1999 IQGAP1 and calmodulin modulate E-cadherin function.
9712880 1998 Characterization of the association of the actin-binding protein, IQGAP, and activated Cdc42 with Golgi membranes.
9368021 1997 Regulation of cross-linking of actin filament by IQGAP1, a target for Cdc42.
9199170 1997 IQGAP1, a Rac- and Cdc42-binding protein, directly binds and cross-links microfilaments.
9182573 1997 Calmodulin modulates the interaction between IQGAP1 and Cdc42. Identification of IQGAP1 by nanoelectrospray tandem mass spectrometry.
8798539 1996 Identification of IQGAP as a putative target for the small GTPases, Cdc42 and Rac1.
8756646 1996 The Ras GTPase-activating-protein-related human protein IQGAP2 harbors a potential actin binding domain and interacts with calmodulin and Rho family GTPases.
8702968 1996 Identification of a putative effector for Cdc42Hs with high sequence similarity to the RasGAP-related protein IQGAP1 and a Cdc42Hs binding partner with similarity to IQGAP2.
8670801 1996 IQGAP1, a calmodulin-binding protein with a rasGAP-related domain, is a potential effector for cdc42Hs.
8051149 1994 Identification of a human rasGAP-related protein containing calmodulin-binding motifs.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.