Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.85
PubTator Score 39.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 4.2e-16
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.3
Celiac disease 116 0.0 1.4
Disease Target Count Z-score Confidence
Neurofibromatosis 40 3.099 1.5

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MRLEELKRLQNPLEQVNDGKYSFENHQLAMDAENNIEKYPLNLQPLESKVKIIQRAWREYLQRQEPLGKR      1 - 70
SPSPPSVSSEKLSSSVSMNTFSDSSTPFARAPVGKIHPYISWRLQSPGDKLPGGRKVILLYLDQLARPTG     71 - 140
FIHTLKEPQIERLGFLTLQ                                                       141 - 159
//

Text Mined References (9)

PMID Year Title