Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.85
PubTator Score 39.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 4.2e-16
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 1.0
Celiac disease 112 0.0 1.0
Disease Target Count Z-score Confidence
Neurofibromatosis 37 3.095 1.5

AA Sequence

MRLEELKRLQNPLEQVNDGKYSFENHQLAMDAENNIEKYPLNLQPLESKVKIIQRAWREYLQRQEPLGKR      1 - 70
SPSPPSVSSEKLSSSVSMNTFSDSSTPFARAPVGKIHPYISWRLQSPGDKLPGGRKVILLYLDQLARPTG     71 - 140
FIHTLKEPQIERLGFLTLQ                                                       141 - 159
//

Text Mined References (7)

PMID Year Title
18550753 2008 Schwannomin-interacting protein-1 isoform IQCJ-SCHIP-1 is a late component of nodes of Ranvier and axon initial segments.
17045569 2006 IQCJ-SCHIP1, a novel fusion transcript encoding a calmodulin-binding IQ motif protein.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.