Property Summary

NCBI Gene PubMed Count 36
PubMed Score 44.40
PubTator Score 26.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Senior-Loken Syndrome 5 1 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3135 1.5e-06
sonic hedgehog group medulloblastoma 459 4.2e-06
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Crohn's disease 311 0.0 0.9

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.200 1.5e-06
sonic hedgehog group medulloblastoma 1.200 4.2e-06

Gene RIF (15)

AA Sequence

MKPTGTDPRILSIAAEVAKSPEQNVPVILLKLKEIINITPLGSSELKKIKQDIYCYDLIQYCLLVLSQDY      1 - 70
SRIQGGWTTISQLTQILSHCCVGLEPGEDAEEFYNELLPSAAENFLVLGRQLQTCFINAAKAEEKDELLH     71 - 140
FFQIVTDSLFWLLGGHVELIQNVLQSDHFLHLLQADNVQIGSAVMMMLQNILQINSGDLLRIGRKALYSI    141 - 210
LDEVIFKLFSTPSPVIRSTATKLLLLMAESHQEILILLRQSTCYKGLRRLLSKQETGTEFSQELRQLVGL    211 - 280
LSPMVYQEVEEQKLHQAACLIQAYWKGFQTRKRLKKLPSAVIALQRSFRSKRSKMLLEINRQKEEEDLKL    281 - 350
QLQLQRQRAMRLSRELQLSMLEIVHPGQVEKHYREMEEKSALIIQKHWRGYRERKNFHQQRQSLIEYKAA    351 - 420
VTLQRAALKFLAKCRKKKKLFAPWRGLQELTDARRVELKKRVDDYVRRHLGSPMSDVVSRELHAQAQERL    421 - 490
QHYFMGRALEERAQQHREALIAQISTNVEQLMKAPSLKEAEGKEPELFLSRSRPVAAKAKQAHLTTLKHI    491 - 560
QAPWWKKLGEESGDEIDVPKDELSIELENLFIGGTKPP                                    561 - 598
//

Text Mined References (35)

PMID Year Title