Property Summary

NCBI Gene PubMed Count 12
PubMed Score 18.63
PubTator Score 12.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 3.1e-05
breast carcinoma 1638 3.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Pneumocystosis 17 3.157 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.400 3.8e-04
osteosarcoma -1.224 3.1e-05

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MEEGKMDENEWGYHGEGNKSLVVAHAQRCVVLRFLKFPPNRKKTSEEIFQHLQNIVDFGKNVMKEFLGEN      1 - 70
YVHYGEVVQLPLEFVKQLCLKIQSERPESRCDKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPK     71 - 140
CGFIPFSSDVTHEMKHKVCRYCMHQHLKVATGKWKQISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLKI    141 - 210
FKNGELIYGCKDARSPVADWSELAHHLKPFFFPSNGLASGPHCTRAVIRELVHVITRVLLSGSDKGRAGT    211 - 280
LSPGLGPQGPRVCEASPFSRSLRCQGKNTPERSGLPKGCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLE    281 - 350
EFPEERKTLQIDGPYDEAFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQDASSDQ    351 - 420
RPVVPSSRSRFAFSVSVLDLDLKPYESIPHQYKLDGKIVNYYSKTVRAKDNAVMSTRFKESEDCTLVLHK    421 - 490
V//

Text Mined References (13)

PMID Year Title