Property Summary

NCBI Gene PubMed Count 32
PubMed Score 43.37
PubTator Score 33.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung adenocarcinoma 2714 5.2e-08
medulloblastoma, large-cell 6234 1.1e-05
osteosarcoma 7933 1.2e-05
ovarian cancer 8491 2.7e-05
psoriasis 6685 3.7e-05
lung cancer 4473 5.1e-04
Multiple myeloma 1327 2.7e-03
Disease Target Count Z-score Confidence
triple-A syndrome 18 3.05 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.615 2.7e-03
psoriasis -2.200 3.7e-05
osteosarcoma 1.852 1.2e-05
medulloblastoma, large-cell 1.500 1.1e-05
lung cancer 1.500 5.1e-04
lung adenocarcinoma 1.183 5.2e-08
ovarian cancer 2.100 2.7e-05

Gene RIF (24)

PMID Text
26085085 Depletion of IPO7 by IPO7 siRNA reduced nuclear accumulation of GLI1. In addition, FOXM1 induced nuclear import of GLI1 by promoting IPO7 expression.
24586428 Importin 7 as a soluble nuclear transport factor that is required for efficient import of the protein component of human telomerase.
24100013 Importin 7 contributes to the regulation of androgen receptor import by restraining import until androgen is detected in the cytoplasm.
23439083 Tandem affinity purification and mass spectrometry analysis identify importin 7 (IPO7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23439083 High levels of additive and synergic antiretroviral activity are obtained by using antiretroviral compounds (T1249, 3TC, RAL, or IDV) in PM1 cells stably expressing anti-host shRNAs (IPO7, HSPD1, or ATG16) or anti-HIV shRNAs (Pol, RT, or Nef)
23125841 Tandem affinity purification and mass spectrometry analysis identify importin 7 (IPO7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23067392 imp7 is a part of an intrinsic pathway that promotes nuclear import of exogenous and endogenous DNA in mammalian cells.
22509482 Tandem affinity purification and mass spectrometry analysis identify importin 7 (IPO7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22284678 Importin 7 (IPO7)is regulated positively by c-Myc and negatively by p53.
22174317 Tandem affinity purification and mass spectrometry analysis identify importin 7 (IPO7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21419860 essential for Egr-1 nuclear translocation
20719241 Tandem affinity purification and mass spectrometry analysis identify importin 7 (IPO7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19788888 importins 4 and 7 accomplish nuclear import of HIF-1alpha more efficiently than the classical importin alpha/beta NLS receptor
19609347 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19435463 Data show that ARHI could compete for Ran-importin binding and induce disruption of importin-binding to cargo proteins, including STAT3.
19193229 Although imp7 may not be essential for HIV-1 infection, our results suggest that imp7 facilitates nuclear trafficking of DNA and that HIV-1 exploits imp7 to maximize nuclear import of its DNA genome.
18519565 TGF-beta-induced and basal state spontaneous nuclear import of Smad4 require importin 7 and 8.
18003734 When the import assay was performed with a low concentration of each importin- subtype, NPI2/importin-7 elicited more efficient transport activity of the human herpesvirus 6 U69 protein
17848547 These results identify EZI as a novel cargo protein for importin-7 and demonstrate a nucleocytoplasmic shuttling mechanism that is mediated by importin-7-dependent nuclear localization and CRM1-independent nuclear export.
17360709 Tandem affinity purification and mass spectrometry analysis identify importin 7 (IPO7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
17020411 Tandem affinity purification and mass spectrometry analysis identify importin 7 (IPO7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12853482 Nuclear import of HIV-1 intracellular reverse transcription is mediated by IPO7.
12853482 Tandem affinity purification and mass spectrometry analysis identify importin 7 (IPO7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12080050 role of IMP7 in nuclear transport of H1 histones

AA Sequence

MDPNTIIEALRGTMDPALREAAERQLNEAHKSLNFVSTLLQITMSEQLDLPVRQAGVIYLKNMITQYWPD      1 - 70
RETAPGDISPYTIPEEDRHCIRENIVEAIIHSPELIRVQLTTCIHHIIKHDYPSRWTAIVDKIGFYLQSD     71 - 140
NSACWLGILLCLYQLVKNYEYKKPEERSPLVAAMQHFLPVLKDRFIQLLSDQSDQSVLIQKQIFKIFYAL    141 - 210
VQYTLPLELINQQNLTEWIEILKTVVNRDVPNETLQVEEDDRPELPWWKCKKWALHILARLFERYGSPGN    211 - 280
VSKEYNEFAEVFLKAFAVGVQQVLLKVLYQYKEKQYMAPRVLQQTLNYINQGVSHALTWKNLKPHIQGII    281 - 350
QDVIFPLMCYTDADEELWQEDPYEYIRMKFDVFEDFISPTTAAQTLLFTACSKRKEVLQKTMGFCYQILT    351 - 420
EPNADPRKKDGALHMIGSLAEILLKKKIYKDQMEYMLQNHVFPLFSSELGYMRARACWVLHYFCEVKFKS    421 - 490
DQNLQTALELTRRCLIDDREMPVKVEAAIALQVLISNQEKAKEYITPFIRPVMQALLHIIRETENDDLTN    491 - 560
VIQKMICEYSEEVTPIAVEMTQHLAMTFNQVIQTGPDEEGSDDKAVTAMGILNTIDTLLSVVEDHKEITQ    561 - 630
QLEGICLQVIGTVLQQHVLEFYEEIFSLAHSLTCQQVSPQMWQLLPLVFEVFQQDGFDYFTDMMPLLHNY    631 - 700
VTVDTDTLLSDTKYLEMIYSMCKKVLTGVAGEDAECHAAKLLEVIILQCKGRGIDQCIPLFVEAALERLT    701 - 770
REVKTSELRTMCLQVAIAALYYNPHLLLNTLENLRFPNNVEPVTNHFITQWLNDVDCFLGLHDRKMCVLG    771 - 840
LCALIDMEQIPQVLNQVSGQILPAFILLFNGLKRAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDE    841 - 910
DGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEYQIFKAIFQTIQNRNPVWYQAL    911 - 980
THGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVPSSFNFGGPAPGMN                981 - 1038
//

Text Mined References (42)

PMID Year Title
26878725 2016 Mutations in nuclear pore genes NUP93, NUP205 and XPO5 cause steroid-resistant nephrotic syndrome.
26085085 2015 Forkhead Box M1 Is Essential for Nuclear Localization of Glioma-associated Oncogene Homolog 1 in Glioblastoma Multiforme Cells by Promoting Importin-7 Expression.
24586428 2014 Importin 7 and Nup358 promote nuclear import of the protein component of human telomerase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24100013 2013 Androgen induces a switch from cytoplasmic retention to nuclear import of the androgen receptor.
23067392 2013 Importin-7 mediates nuclear trafficking of DNA in mammalian cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22284678 2012 Importin 7 and exportin 1 link c-Myc and p53 to regulation of ribosomal biogenesis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21419860 2011 Nuclear import of early growth response-1 involves importin-7 and the novel nuclear localization signal serine-proline-serine.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19788888 2009 Transport of hypoxia-inducible factor HIF-1alpha into the nucleus involves importins 4 and 7.
19609347 2009 A genome-wide association study of hypertension and blood pressure in African Americans.
19435463 2009 ARHI (DIRAS3), an imprinted tumour suppressor gene, binds to importins and blocks nuclear import of cargo proteins.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19193229 2009 HIV-1 exploits importin 7 to maximize nuclear import of its DNA genome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18519565 2008 Preferential utilization of Imp7/8 in nuclear import of Smads.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18003734 2008 Characterization of the human herpesvirus 6 U69 gene product and identification of its nuclear localization signal.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17848547 2007 Nucleocytoplasmic shuttling of the zinc finger protein EZI Is mediated by importin-7-dependent nuclear import and CRM1-independent export mechanisms.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16704975 2006 Multiple importins function as nuclear transport receptors for the Rev protein of human immunodeficiency virus type 1.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15964792 2005 Subunits of the heterotrimeric transcription factor NF-Y are imported into the nucleus by distinct pathways involving importin beta and importin 13.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15282309 2004 Inhibition of nuclear import by the proapoptotic protein CC3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853482 2003 Nuclear import of HIV-1 intracellular reverse transcription complexes is mediated by importin 7.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12080050 2002 The requirement of H1 histones for a heterodimeric nuclear import receptor.
11682607 2001 Signal recognition particle protein 19 is imported into the nucleus by importin 8 (RanBP8) and transportin.
10228156 1999 The importin beta/importin 7 heterodimer is a functional nuclear import receptor for histone H1.
10209022 1999 CRM1-mediated recycling of snurportin 1 to the cytoplasm.
9687515 1998 Importin beta, transportin, RanBP5 and RanBP7 mediate nuclear import of ribosomal proteins in mammalian cells.
9214382 1997 A novel class of RanGTP binding proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.