Property Summary

NCBI Gene PubMed Count 68
PubMed Score 149.52
PubTator Score 46.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.800 1.7e-02
colon cancer 1.200 4.7e-02
ependymoma -1.400 3.0e-02
glioblastoma -1.800 3.5e-08
group 3 medulloblastoma 1.100 2.1e-03
hereditary spastic paraplegia -1.084 1.2e-02
interstitial lung disease -1.400 2.0e-02
invasive ductal carcinoma -1.140 8.0e-04
lung cancer 1.500 1.5e-03
medulloblastoma, large-cell 1.200 1.5e-04
Multiple myeloma 1.038 8.7e-03
nasopharyngeal carcinoma 1.200 8.9e-04
oligodendroglioma -1.300 3.5e-02
ovarian cancer -2.100 1.0e-07
pediatric high grade glioma -1.200 3.2e-04
primary pancreatic ductal adenocarcinoma -1.120 1.8e-02
Waldenstrons macroglobulinemia 1.138 1.2e-02

Gene RIF (52)

AA Sequence

MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLL      1 - 70
SSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEGLKFLFDSV     71 - 140
SSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIRTLSARATAAFILANEHNVAL    141 - 210
FKHFADLLPGFLQAVNDSCYQNDDSVLKSLVEIADTVPKYLRPHLEATLQLSLKLCGDTSLNNMQRQLAL    211 - 280
EVIVTLSETAAAMLRKHTNIVAQTIPQMLAMMVDLEEDEDWANADELEDDDFDSNAVAGESALDRMACGL    281 - 350
GGKLVLPMIKEHIMQMLQNPDWKYRHAGLMALSAIGEGCHQQMEGILNEIVNFVLLFLQDPHPRVRYAAC    351 - 420
NAVGQMATDFAPGFQKKFHEKVIAALLQTMEDQGNQRVQAHAAAALINFTEDCPKSLLIPYLDNLVKHLH    421 - 490
SIMVLKLQELIQKGTKLVLEQVVTSIASVADTAEEKFVPYYDLFMPSLKHIVENAVQKELRLLRGKTIEC    491 - 560
ISLIGLAVGKEKFMQDASDVMQLLLKTQTDFNDMEDDDPQISYMISAWARMCKILGKEFQQYLPVVMGPL    561 - 630
MKTASIKPEVALLDTQDMENMSDDDGWEFVNLGDQQSFGIKTAGLEEKSTACQMLVCYAKELKEGFVEYT    631 - 700
EQVVKLMVPLLKFYFHDGVRVAAAESMPLLLECARVRGPEYLTQMWHFMCDALIKAIGTEPDSDVLSEIM    701 - 770
HSFAKCIEVMGDGCLNNEHFEELGGILKAKLEEHFKNQELRQVKRQDEDYDEQVEESLQDEDDNDVYILT    771 - 840
KVSDILHSIFSSYKEKVLPWFEQLLPLIVNLICPHRPWPDRQWGLCIFDDVIEHCSPASFKYAEYFLRPM    841 - 910
LQYVCDNSPEVRQAAAYGLGVMAQYGGDNYRPFCTEALPLLVRVIQSADSKTKENVNATENCISAVGKIM    911 - 980
KFKPDCVNVEEVLPHWLSWLPLHEDKEEAVQTFNYLCDLIESNHPIVLGPNNTNLPKIFSIIAEGEMHEA    981 - 1050
IKHEDPCAKRLANVVRQVQTSGGLWTECIAQLSPEQQAAIQELLNSA                          1051 - 1097
//

Text Mined References (80)

PMID Year Title