Property Summary

NCBI Gene PubMed Count 25
PubMed Score 51.10
PubTator Score 22.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession O94829 D3DPY4 Q5T4X3 Q7LC04 Q96HS3 Q9H8N3 Q9UFR1 Imp13
Symbols LGL2
IMP13
KAP13
RANBP13

Gene

PANTHER Protein Class (1)

PDB

2XWU   2X19   3ZJY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

PMID Text
23620300 IPO13 influenced intracellular distribution of CTCF.
23559854 IPO13 may contribute to the pathogenesis of pterygium via modulation of K17 and c-Jun.
23435562 Imp13 is able to bind and export eIF1A in vivo and that its function is essential.
22648251 These results demonstrate an increased expression of IPO13 in endometriosis and endometrial carcinoma.
21804459 Data show that expression of IPO13, c-kit, telomerase, caspase3, and CD146 are decreased in endometrial polyps; however, the expression of bcl-2 was increased in polyps compared to the normal endometrial tissue.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19619331 IPO13 variation may improve nuclear bioavailability of endogenous glucocorticoids
19619331 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19593795 IPO13 is uniquely expressed by human limbal basal epithelial cells, and plays an important role in maintaining the phenotype, high proliferative potential, and less differentiation of corneal epithelial progenitor cells.
19218565 Importin 13 mediates nuclear import of histone fold-containing chromatin accessibility complex heterodimers
17828378 Imp13 functions in myopodin import and the regulation of this event is critical for normal and abnormal cellular differentiation.

AA Sequence

MERREEQPGAAGAGAAPALDFTVENVEKALHQLYYDPNIENKNLAQKWLMQAQVSPQAWHFSWQLLQPDK      1 - 70
VPEIQYFGASALHIKISRYWSDIPTDQYESLKAQLFTQITRFASGSKIVLTRLCVALASLALSMMPDAWP     71 - 140
CAVADMVRLFQAEDSPVDGQGRCLALLELLTVLPEEFQTSRLPQYRKGLVRTSLAVECGAVFPLLEQLLQ    141 - 210
QPSSPSCVRQKVLKCFSSWVQLEVPLQDCEALIQAAFAALQDSELFDSSVEAIVNAISQPDAQRYVNTLL    211 - 280
KLIPLVLGLQEQLRQAVQNGDMETSHGICRIAVALGENHSRALLDQVEHWQSFLALVNMIMFCTGIPGHY    281 - 350
PVNETTSSLTLTFWYTLQDDILSFEAEKQAVYQQVYRPVYFQLVDVLLHKAQFPSDEEYGFWSSDEKEQF    351 - 420
RIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTSSEEPYSWQHTEALLYGFQSIAETIDVNYSDVVPG    421 - 490
LIGLIPRISISNVQLADTVMFTIGALSEWLADHPVMINSVLPLVLHALGNPELSVSSVSTLKKICRECKY    491 - 560
DLPPYAANIVAVSQDVLMKQIHKTSQCMWLMQALGFLLSALQVEEILKNLHSLISPYIQQLEKLAEEIPN    561 - 630
PSNKLAIVHILGLLSNLFTTLDISHHEDDHEGPELRKLPVPQGPNPVVVVLQQVFQLIQKVLSKWLNDAQ    631 - 700
VVEAVCAIFEKSVKTLLDDFAPMVPQLCEMLGRMYSTIPQASALDLTRQLVHIFAHEPAHFPPIEALFLL    701 - 770
VTSVTLTLFQQGPRDHPDIVDSFMQLLAQALKRKPDLFLCERLDVKAVFQCAVLALKFPEAPTVKASCGF    771 - 840
FTELLPRCGEVESVGKVVQEDGRMLLIAVLEAIGGQASRSLMDCFADILFALNKHCFSLLSMWIKEALQP    841 - 910
PGFPSARLSPEQKDTFSQQILRERVNKRRVKEMVKEFTLLCRGLHGTDYTADY                     911 - 963
//

Text Mined References (29)

PMID Year Title
26816005 2016 Homologous Transcription Factors DUX4 and DUX4c Associate with Cytoplasmic Proteins during Muscle Differentiation.
25416956 2014 A proteome-scale map of the human interactome network.
23620300 2013 CCCTC-binding factor controls its own nuclear transport via regulating the expression of importin 13.
23559854 2013 Increased importin 13 activity is associated with the pathogenesis of pterygium.
23435562 2013 Structural basis for the nuclear export activity of Importin13.
22648251 2012 Increased expression of importin13 in endometriosis and endometrial carcinoma.
21804459 2011 The expression levels of stem cell markers importin13, c-kit, CD146, and telomerase are decreased in endometrial polyps.
21269460 2011 Initial characterization of the human central proteome.
21139563 2011 Structure of Importin13-Ubc9 complex: nuclear import and release of a key regulator of sumoylation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20122403 2010 Nuclear import mechanism of the EJC component Mago-Y14 revealed by structural studies of importin 13.
19619331 2009 Importin-13 genetic variation is associated with improved airway responsiveness in childhood asthma.
19593795 2009 Importin 13 serves as a potential marker for corneal epithelial progenitor cells.
19218565 2009 Importin 13 mediates nuclear import of histone fold-containing chromatin accessibility complex heterodimers.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17828378 2008 Interaction between importin 13 and myopodin suggests a nuclear import pathway for myopodin.
17652081 2007 Nuclear import of c-Jun is mediated by multiple transport receptors.
16809634 2006 Importin 13 regulates nuclear import of the glucocorticoid receptor in airway epithelial cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15964792 2005 Subunits of the heterotrimeric transcription factor NF-Y are imported into the nucleus by distinct pathways involving importin beta and importin 13.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15143176 2004 Paired-type homeodomain transcription factors are imported into the nucleus by karyopherin 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12600309 2003 Regulating access to the genome: nucleocytoplasmic transport throughout the cell cycle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11447110 2001 Importin 13: a novel mediator of nuclear import and export.
10745026 2000 A novel karyopherin-beta homolog is developmentally and hormonally regulated in fetal lung.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.