Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.87
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -3.200 1.8e-03
posterior fossa group A ependymoma -4.400 1.5e-17
oligodendroglioma -2.800 1.0e-02
cutaneous lupus erythematosus 1.500 2.5e-02
glioblastoma -4.700 1.6e-09
osteosarcoma -3.225 2.2e-06
medulloblastoma -4.700 2.5e-09
atypical teratoid / rhabdoid tumor -4.200 1.2e-08
medulloblastoma, large-cell -5.200 1.9e-08
primitive neuroectodermal tumor -5.100 3.1e-08
lung cancer -1.800 1.2e-04
adult high grade glioma -3.700 1.8e-05
pilocytic astrocytoma -3.600 2.7e-09
pituitary cancer 2.300 3.8e-06
Down syndrome -1.100 1.5e-03

Gene RIF (7)

PMID Text
22085542 CNK3 and IPCEF1 produce a single protein that is required for HGF dependent Arf6 activation and migration.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20016009 protein-protein interaction mediated by ARNO coiled-coil domain required for ARNO induced motility; coiled-coil domain promotes assembly of multiprotein complex containing ARNO and Dock180; assembly of complex requires coiled-coil domain, GRASP and IPCEF
19913121 Observational study of gene-disease association. (HuGE Navigator)
17067457 PTEN may down-regulate the expression of PIP3, and then down-regulate the expression of cyclin D1, which leads to the suppression of cell growth.
12920129 IPCEF1 increases the in vitro and in vivo stimulation of ARFGTP formation by cytohesin 2

AA Sequence

MTSYMAIDGSALVPLRQKPRRKTQGFLTMSRRRISCKDLGHADCQGWLYKKKEKGSFLSNKWKKFWVILK      1 - 70
GSSLYWYSNQMAEKADGFVNLPDFTVERASECKKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLGSAVI     71 - 140
HQESTTKDEECYSESEQEDPEIAAETPPPPHASQTQSLTAQQASSSSPSLSGTSYSFSSLENTVKTPSSF    141 - 210
PSSLSKERQSLPDTVNSLSAAEDEGQPITFAVQVHSPVPSEAGIHKALENSFVTSESGFLNSLSSDDTSS    211 - 280
LSSNHDHLTVPDKPAGSKIMDKEETKVSEDDEMEKLYKSLEQASLSPLGDRRPSTKKELRKSFVKRCKNP    281 - 350
SINEKLHKIRTLNSTLKCKEHDLAMINQLLDDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDT    351 - 420
PQELKKSPSSPSVENSI                                                         421 - 437
//

Text Mined References (18)

PMID Year Title
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
22085542 2012 CNK3 and IPCEF1 produce a single protein that is required for HGF dependent Arf6 activation and migration.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20016009 2010 GRASP and IPCEF promote ARF-to-Rac signaling and cell migration by coordinating the association of ARNO/cytohesin 2 with Dock180.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19756519 2009 Peripheral nerve injury up-regulates expression of interactor protein for cytohesin exchange factor 1 (IPCEF1) mRNA in rat dorsal root ganglion.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17067457 2006 [Expression of tumor suppressor gene PTEN, PIP3 and cyclin D1 in oral squamous cell carcinoma and their correlations].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12920129 2003 Interaction protein for cytohesin exchange factors 1 (IPCEF1) binds cytohesin 2 and modifies its activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11919282 2002 Cytoglobin: a novel globin type ubiquitously expressed in vertebrate tissues.
11804589 2002 Identification of ARAP3, a novel PI3K effector regulating both Arf and Rho GTPases, by selective capture on phosphoinositide affinity matrices.
11320098 2001 Characterization of a stellate cell activation-associated protein (STAP) with peroxidase activity found in rat hepatic stellate cells.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.