Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.19
PubTator Score 4.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Pulmonary function (finding) 33
Disease Target Count P-value
group 3 medulloblastoma 2254 2.8e-04
glioblastoma 5572 6.2e-04
ovarian cancer 8491 6.3e-04
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.300 6.2e-04
group 3 medulloblastoma 1.100 2.8e-04
ovarian cancer 1.500 6.3e-04

 GO Function (1)

Gene RIF (4)

PMID Text
24058608 In fixed sections of human lung tissue, GSTCD protein expression was ubiquitous, whereas INTS12 expression was predominantly in epithelial cells and pneumocytes.
20332099 Observational study of gene-disease association. (HuGE Navigator)
20010835 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of integrator complex subunit 12 (INTS12; SBBI22) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MAATVNLELDPIFLKALGFLHSKSKDSAEKLKALLDESLARGIDSSYRPSQKDVEPPKISSTKNISIKQE      1 - 70
PKISSSLPSGNNNGKVLTTEKVKKEAEKRPADKMKSDITEGVDIPKKPRLEKPETQSSPITVQSSKDLPM     71 - 140
ADLSSFEETSADDFAMEMGLACVVCRQMMVASGNQLVECQECHNLYHRDCHKPQVTDKEANDPRLVWYCA    141 - 210
RCTRQMKRMAQKTQKPPQKPAPAVVSVTPAVKDPLVKKPETKLKQETTFLAFKRTEVKTSTVISGNSSSA    211 - 280
SVSSSVTSGLTGWAAFAAKTSSAGPSTAKLSSTTQNNTGKPATSSANQKPVGLTGLATSSKGGIGSKIGS    281 - 350
NNSTTPTVPLKPPPPLTLGKTGLSRSVSCDNVSKVGLPSPSSLVPGSSSQLSGNGNSGTSGPSGSTTSKT    351 - 420
TSESSSSPSASLKGPTSQESQLNAMKRLQMVKKKAAQKKLKK                                421 - 462
//

Text Mined References (18)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24058608 2013 GSTCD and INTS12 regulation and expression in the human lung.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20010835 2010 Meta-analyses of genome-wide association studies identify multiple loci associated with pulmonary function.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16239144 2005 Integrator, a multiprotein mediator of small nuclear RNA processing, associates with the C-terminal repeat of RNA polymerase II.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.