Property Summary

NCBI Gene PubMed Count 22
PubMed Score 342.30
PubTator Score 190.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
oligodendroglioma 1.700 3.4e-02
posterior fossa group B ependymoma -2.200 5.9e-04
group 4 medulloblastoma 4.700 5.4e-07
medulloblastoma, large-cell 3.900 2.0e-04
lung cancer 1.800 2.2e-05
colon cancer -1.300 2.3e-05
pilocytic astrocytoma -2.500 1.5e-04
aldosterone-producing adenoma -2.085 1.5e-02
nasopharyngeal carcinoma 1.600 2.5e-02

Gene RIF (17)

PMID Text
27072116 Small cell lung cancer tissues were strongly positive for INSM1. INSM1 signal was not detected on normal adjacent tissues from lung cancer patients or normal lung tissues
26530405 the INSM1-promoter specific conditional replicating adenovirus represents a sensitive diagnostic tool to aid clinicians in the detection of NE tumors.
26482608 Insulinoma-Associated Protein 1 is a crucial regulator of neuroendocrine differentiation in lung cancer.
26386079 INSM1 expression was significantly increased in Neuroendocrine neoplastic vs nonneoplastic tissue.
25523979 INSM1 autoantibodies were associated with risk of developing type 1 diabetes.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of insulinoma-associated 1 (INSM1) in peptide-treated PBMCs
21830214 Both the AR42J cell line and the primary cultured mouse acinar cells support role for INSM1 in pancreatic acinar cell trans-differentiation model.
21609490 The results suggest that INSM1 up-regulation plays a positive role in HSV-1 replication, probably by binding to the ICP0 promoter.
20215568 Data show that the consistent functional effect of INSM1, either with or without other ITFs, promotes pancreatic duct cell differentiation as well as induces Panc-1 cell cycle arrest.
19604042 The INSM1 promoter can direct herpes simplex virus thymidine kinase gene expression in a nude mouse model of neuroendocrine cancer and effectively repress tumor growth in response to ganciclovir treatment.
19246490 INSM1 role as an important regulator during neuroendocrine differentiation [review]
18417529 INSM1 is a new zinc-finger transcription factor that modulates insulin gene transcription during early pancreas development.
18205207 in mice and humans, INSM1 is likewise expressed transiently during terminal neurogenic divisions, from late progenitors to nascent neurons, and particularly during symmetric neuronogenic divisions.
18051367 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of insulinoma-associated 1 (INSM1) in peptide-treated PBMCs
16569215 results presented in this study define INSM1 as a transcriptional repressor of the neuroD/b2 gene. The molecular mechanism of INSM1 transcriptional repression is attributed to the recruitment of cyclin D1 and HDAC-1 and -3
12890672 IA-1 gene is developmentally expressed in the nervous system and the NeuroD1/E47 transcription factors up-regulate IA-1 gene expression through the proximal E-box element of the IA-1 promoter
11854618 IA-1 gene was shown to be developmentally regulated in fetal pancreatic cells, and its expression pattern is consistent with parallel changes in islet-specific transcription factors during the endocrine differentiation of AR42J cells.

AA Sequence

MPRGFLVKRSKKSTPVSYRVRGGEDGDRALLLSPSCGGARAEPPAPSPVPGPLPPPPPAERAHAALAAAL      1 - 70
ACAPGPQPPPQGPRAAHFGNPEAAHPAPLYSPTRPVSREHEKHKYFERSFNLGSPVSAESFPTPAALLGG     71 - 140
GGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAARGPGPGPPLPPAAALRPPGKRPPPPTAAEP    141 - 210
PAKAVKAPGAKKPKAIRKLHFEDEVTTSPVLGLKIKEGPVEAPRGRAGGAARPLGEFICQLCKEEYADPF    211 - 280
ALAQHKCSRIVRVEYRCPECAKVFSCPANLASHRRWHKPRPAPAAARAPEPEAAARAEAREAPGGGSDRD    281 - 350
TPSPGGVSESGSEDGLYECHHCAKKFRRQAYLRKHLLAHHQALQAKGAPLAPPAEDLLALYPGPDEKAPQ    351 - 420
EAAGDGEGAGVLGLSASAECHLCPVCGESFASKGAQERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINK    421 - 490
CHPSENRQVILLQVPVRPAC                                                      491 - 510
//

Text Mined References (22)

PMID Year Title
27072116 2016 Ectopic expression of a small cell lung cancer transcription factor, INSM1 impairs alveologenesis in lung development.
26530405 2016 Detection of neuroendocrine tumors using promoter-specific secreted Gaussia luciferase.
26482608 2015 Insulinoma-Associated Protein 1 Is a Crucial Regulator of Neuroendocrine Differentiation in Lung Cancer.
26386079 2015 INSM1: A Novel Immunohistochemical and Molecular Marker for Neuroendocrine and Neuroepithelial Neoplasms.
25523979 2015 Autoantibody-defined risk for Type 1 diabetes mellitus in a general population of schoolchildren: results of the Karlsburg Type 1 Diabetes Risk Study after 18 years.
21830214 2012 Functional role of an islet transcription factor, INSM1/IA-1, on pancreatic acinar cell trans-differentiation.
21609490 2011 Herpes simplex virus induces the marked up-regulation of the zinc finger transcriptional factor INSM1, which modulates the expression and localization of the immediate early protein ICP0.
20215568 2010 Insulinoma-associated antigen-1 zinc-finger transcription factor promotes pancreatic duct cell trans-differentiation.
19604042 2009 INSM1 promoter-driven adenoviral herpes simplex virus thymidine kinase cancer gene therapy for the treatment of primitive neuroectodermal tumors.
19246490 2009 Structure, expression, and biological function of INSM1 transcription factor in neuroendocrine differentiation.
19124461 2009 Zinc finger transcription factor INSM1 interrupts cyclin D1 and CDK4 binding and induces cell cycle arrest.
18417529 2008 Identification of an INSM1-binding site in the insulin promoter: negative regulation of the insulin gene transcription.
18205207 2008 Transient expression of the conserved zinc finger gene INSM1 in progenitors and nascent neurons throughout embryonic and adult neurogenesis.
16569215 2006 INSM1 functions as a transcriptional repressor of the neuroD/beta2 gene through the recruitment of cyclin D1 and histone deacetylases.
16511571 2006 IA1 is NGN3-dependent and essential for differentiation of the endocrine pancreas.
12890672 2003 NeuroD1/E47 regulates the E-box element of a novel zinc finger transcription factor, IA-1, in developing nervous system.
12079283 2002 The zinc-finger transcription factor INSM1 is expressed during embryo development and interacts with the Cbl-associated protein.
11842116 2002 Neuroendocrine differentiation factor, IA-1, is a transcriptional repressor and contains a specific DNA-binding domain: identification of consensus IA-1 binding sequence.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9245732 1997 Molecular characterization of the promoter region of a neuroendocrine tumor marker, IA-1.
8188699 1994 Genomic organization, 5'-upstream sequence, and chromosomal localization of an insulinoma-associated intronless gene, IA-1.
1634555 1992 A novel human insulinoma-associated cDNA, IA-1, encodes a protein with "zinc-finger" DNA-binding motifs.