Property Summary

NCBI Gene PubMed Count 18
PubMed Score 26.91
PubTator Score 14.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cryptorchidism 287 3.345 1.7

Expression

Gene RIF (10)

AA Sequence

MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHK      1 - 70
REFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC          71 - 135
//

Text Mined References (20)

PMID Year Title