Property Summary

NCBI Gene PubMed Count 86
PubMed Score 84.04
PubTator Score 109.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Weight Gain 87
Disease Target Count P-value
psoriasis 6685 2.6e-06
ovarian cancer 8491 9.9e-05
tuberculosis 1563 1.4e-03
medulloblastoma, large-cell 6234 1.0e-02
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 2.0
Disease Target Count Z-score Confidence
Obesity 616 4.885 2.4

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.100 2.6e-06
medulloblastoma, large-cell -1.200 1.0e-02
tuberculosis -1.100 1.4e-03
ovarian cancer -1.500 9.9e-05

Gene RIF (112)

PMID Text
26827442 Insulin resistance in obese boys leads to up-regulation of INSIG2 gene expression as well as to down-regulation of PFKFB1, PFKFB3, and HK2 genes in the blood cells as compared to obese patients with normal insulin sensitivity.
26662938 There may be a connection between INSIG2 expression and metastatic dissemination of colorectal cancer without any effect on tumorigenesis.
25607990 Results confirmed that genetic variation in INSIG2 is associated with both overweight and LDL in non-Hispanic white children.
25062423 The INSIG2 rs7566605 SNP may not play a role in the development of obesity-related metabolic traits in Malaysian Malays.
25028659 identified interaction of three genes in INSIG-SCAP-SREBP pathway on risk of obesity, revealing that these genes affect obesity more likely through a complex interaction pattern than single gene effect.
24518831 INSIG2 is involved in adipogenesis and MC4R effects hormonal appetite control in response to the amount of adipose tissue.
24458218 The results provided evidence for identifying genetic factors of nonalcoholic fatty liver disease (NAFLD) and may be useful for risk assessment and personalized medicine of NAFLD.
24371122 Data show the essential role of PPARgamma and PPARgamma coactivator 1alpha (PGC-1alpha) in up-regulating Insig-1/2 expression, defining a mechanistic pathway triggered by CD36, and leading to cholesterol depletion in hepatocytes.
23941145 This study suggests that the G allele in the INSIG2 single nucleotide polymorphism rs7566605 is more relevant for changes in intramuscular adipose tissue following training than for the amount of subcutaneous fat.
22968099 genetic association/nutrigenomics studies of populations in Samoa: Data suggest that an SNP in INSIG2 (rs9308762) is associated with increased risk of metabolic syndrome X in Samoans eating modern diet (rather than traditional Samoan diet).
22695173 Results show significant differences in distribution of single nucleotide polymorphism in this gene amongst whites and hispanics
22355322 Single nucleotide polymorphism in INSIG2 is associated with asthma susceptibility through gene-gene interactions.
22020349 INSIG2 was significantly associated with fasting plasma glucose in patients with schizophrenia
21978759 Results indicated that the G-102A INSIG2 polymorphism has no consistent effect on BMI in general populations, but could influence HDL cholesterol in females.
21544599 No significant associations were observed between rs7566605 near the INSIG2 gene and any adiposity-related phenotypes in African- and European-American youth.
21443541 Insig2 is overexpressed in pancreatic cancer under hypoxic conditions and is correlated with the malignant behaviors of pancreatic cancer. Insig2 knockdown decreased the cell proliferation and invasion of human pancreatic cancer cell line SUIT-2.
21163096 The rs13428113 polymorphism in INSIG2 gene was associated with abnormal lipid metabolism in overweight and obese children.
20955599 the INSIG2 rs7566605 polymorphism is not associated with body mass index and breast cancer risk
20955599 Observational study of gene-disease association. (HuGE Navigator)
20920244 genetic polymorphism along with sex and age factors contribute to prevalence of cardiovascular disease
20920244 Observational study of gene-disease association. (HuGE Navigator)
20877301 In single-marker-based analysis, the INSIG2 rs11123469-C homozygous genotype was found to be more frequent in patients with metabolic syndrome than those without metabolic syndrome.
20877301 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20858904 These results suggest that INSIG2 genetic variants may have a more direct role in lipid and apolipoprotein B/lipoprotein metabolism than in obesity.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20816152 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20653998 Results indicated that this INSIG2 polymorphism has no significant effect on body mass index and plasma lipids in the Czech Slavonic population.
20653998 Observational study of gene-disease association. (HuGE Navigator)
20645959 While study did not confirm an association between rs7566605 and BMI in obese children in Sardinia, abnormalities of glucose metabolism and genotype, indicate that INSIG2 may be involved in glucose metabolism.
20645959 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20538960 Observational study of gene-disease association. (HuGE Navigator)
20504252 Observational study of gene-disease association. (HuGE Navigator)
20373477 This study was unable to replicate significant associations in patients of European ancestry and weight-gain induced by antipsychotics with single-nucleotide polymorphisms in Insulin Induced Gene 2.
20373477 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20145255 Deletion analyses on 3 kb of 5'-flanking DNA of the INSIG2 gene revealed the functional importance of a 350-bp region upstream of the transcription start site.
20092643 Observational study of gene-disease association. (HuGE Navigator)
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20045156 a role of INSIG2 sequence variation in the regulation of cholesterol metabolism.
20045156 Observational study of gene-disease association. (HuGE Navigator)
20028541 this study suggests that sequence variants in INSIG2 likely influence the risk for obesity related traits
20028541 Observational study of gene-disease association. (HuGE Navigator)
20007308 A total of 15.1% of participants were overweight or obese at age 16 y. No associations with INSIG2 were found.
20007308 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851442 Meta-analysis of gene-disease association. (HuGE Navigator)
19772594 we suggest the possible involvement of INSIG2 with the plasma level of the total cholesterol in women
19772594 Observational study of gene-disease association. (HuGE Navigator)
19740467 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19638338 Studies define Insig-1 and Insig-2 as the minimal requirement for sterol-accelerated degradation of the membrane domain of reductase.
19523229 INSIG2 rs7566605 variant does not play a major role in determining obesity risk in a racially and ethnically diverse sample of 24,722 individuals from four cohorts
19523229 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19399648 K121Q, rs7566605, and rs894160 are not major contributing factors for obesity for ENPP1, INSIG2 and PLIN
19399648 Observational study of gene-disease association. (HuGE Navigator)
19360016 INSIG2 SNPs are associated with obesity and glucose homeostasis traits in Hispanics
19360016 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19263810 INSIG2 rs7566605 variant is not associated Chinese childhood obesity in two independent cohorts.
19263810 Observational study of gene-disease association. (HuGE Navigator)
19224890 children with the combination of the INSIG2 CC genotype and the FTO AA genotype showed the worst outcome in a lifestyle intervention, suggesting that the effects of INSIG2 and FTO aggravate each other.
19224890 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19197262 The rs7566605 INSIG2 gene polymorphism is not associated with obesity-related traits and lipids in the European Youth Heart Study.
19197262 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19197259 The single nucleotide polymorphism rs7566605 near the INSIG2 gene does not influence body mass index and is not associated directly with coronary artery disease or myocardial infarction or indirectly through cardiovascular risk factors.
19197259 Observational study of gene-disease association. (HuGE Navigator)
19105843 Our results show that the INSIG2 rs7566605 polymorphism underlies variation in subcutaneous adiposity in young adult women and suppresses the positive effects of resistance training on men
19105843 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18989534 The INSIG1 gene, not the INSIG2 gene, associated with coronary heart disease: tagSNPs and haplotype-based association study.
18989534 Observational study of gene-disease association. (HuGE Navigator)
18839134 common variants in FTO and INSIG2 are nominally associated with quantitative measures of obesity
18839134 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18682847 INSIG2 polymorphisms play no apparent role in the development of common forms of obesity in the Danish population but may influence body mass index and physical activity.
18682847 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18615239 rs7566605 in the upstream region of the INSIG2 gene was found to be associated with obesity, i.e., severe obesity, in Japanese.
18615239 Observational study of gene-disease association. (HuGE Navigator)
18570692 it is suggested that the CC genotype of the INSIG2 upstream SNP, rs7566605, is a protective genetic factor against hypercholesterolaemia, when exposed to a high-fat diet.
18570692 Observational study of gene-disease association. (HuGE Navigator)
18514965 Polymorphism may be associated with obesity and body mass index in an Indian population.
18514965 Observational study of gene-disease association. (HuGE Navigator)
18464289 Insig2 is a novel colon cancer biomarker, and suggest, for the first time, a reasonable connection between Insig2 and Bax-mediated apoptosis through the mitochondrial pathway.
18426866 Observational study of gene-disease association. (HuGE Navigator)
18398047 Observational study of gene-disease association. (HuGE Navigator)
18347269 Increased BMI in morbid obesity is associated with a combination of FTO and INSIG2 SNPs.
18347269 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18319320 INSIG2 is involved in adipocyte metabolism and body weight regulation.
18319320 Observational study of gene-disease association. (HuGE Navigator)
18270535 found no significant association of rs7566605 polymorphism with body mass index (BMI) and waist circumference among all participants (P=0.52), however in subjects from Shangai, the C/C genotype was associated with higher risk of BMI and obesity
18270535 Observational study of gene-disease association. (HuGE Navigator)
18239574 results do not support an association of the INSIG2 gene with the regulation of body weight or parameters related to lipoprotein metabolism
18239574 Observational study of gene-disease association. (HuGE Navigator)
18223638 There is a lack of association between single-nucleotide polymorphism rs7566605 and being overweight among the Japanese (in the middle-aged and elderly population).
18223638 Observational study of gene-disease association. (HuGE Navigator)
18195716 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18162505 Observational study of gene-disease association. (HuGE Navigator)
18070740 There is no association of the rs7566605 variant with overweight in Japanese people.
18070740 Observational study of gene-disease association. (HuGE Navigator)
18003761 Children who were CC-homozygotes at SNP rs7566605 in the vicinity of INSIG2 lost less weight in this lifestyle intervention.
18003761 Observational study of gene-disease association. (HuGE Navigator)
17489846 Observational study of gene-disease association. (HuGE Navigator)
17489846 the variant upstream of INSIG2 is not a determinant of BMI in Indian population.
17471297 The rs7566605 single-nucleotide polymorphism (SNP) was not related to plasma triglyceride levels. This suggests that, at the least, the true size of the effect on obesity of this SNP is likely to be considerably less than reported previously.
17471297 Observational study of gene-disease association. (HuGE Navigator)
17465681 Observational study of gene-disease association. (HuGE Navigator)
17465681 The association of a SNP upstream of INSIG2 with body mass index is not reproduced in all cohorts.
17428920 INSIG-2 is a membrane bound oxysterol-binding protein with specificity for cholesterol derivatives that possess hydroxyl groups on the side chain.
17137505 Observational study of gene-disease association. (HuGE Navigator)
16614226 Observational study of genotype prevalence. (HuGE Navigator)
16606821 These studies identify a aspartic acid residue that is crucial for the function of Insig1 and Insig2 proteins in regulating cholesterol homeostasis in mammalian cells.
16549805 degradation of ubiquitinated Insigs is controlled by serine residues flanking the sites of ubiquitination
12842885 Required for sterol-regulated transport of SREBPs from ER to Golgi.

AA Sequence

MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSA      1 - 70
WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAAL     71 - 140
SIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQL    141 - 210
AMYECKVIAEKSHQE                                                           211 - 225
//

Text Mined References (89)

PMID Year Title
26827442 [EXPRESSION OF GENES, WHICH CONTROL GLUCOSE METABOLISM, IN BLOOD CELLS OF THE OBESE BOYS WITH INSULIN RESISTANCE].
26662938 2016 Insulin-induced gene 2 expression correlates with colorectal cancer metastasis and disease outcome.
25607990 2015 Association of INSIG2 polymorphism with overweight and LDL in children.
25416956 2014 A proteome-scale map of the human interactome network.
25062423 2014 Genetic associations of the INSIG2 rs7566605 polymorphism with obesity-related metabolic traits in Malaysian Malays.
25028659 2014 The gene-gene interaction of INSIG-SCAP-SREBP pathway on the risk of obesity in Chinese children.
24518831 2014 Controversial association results for INSIG2 on body mass index may be explained by interactions with age and with MC4R.
24458218 2014 Association of INSIG2 rs9308762 with ALT level independent of BMI.
24371122 2014 Scavenger receptor CD36 mediates inhibition of cholesterol synthesis via activation of the PPAR?/PGC-1? pathway and Insig1/2 expression in hepatocytes.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23941145 2014 Association between intramuscular fat in the arm following arm training and INSIG2.
22968099 2013 INSIG2 variants, dietary patterns and metabolic risk in Samoa.
22695173 Frequencies of obesity susceptibility alleles among ethnically and racially diverse bariatric patient populations.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22355322 2012 Gene-gene and gene-environmental interactions of childhood asthma: a multifactor dimension reduction approach.
22020349 2011 Polymorphisms of INSIG2, MC4R, and LEP are associated with obesity- and metabolic-related traits in schizophrenic patients.
21978759 2011 INSIG2 G-102A promoter variant exhibits context-dependent effect on HDL-cholesterol levels but not on BMI in Caucasians.
21544599 2011 Influence of common variants in FTO and near INSIG2 and MC4R on growth curves for adiposity in African- and European-American youth.
21443541 2011 Insig2 is overexpressed in pancreatic cancer and its expression is induced by hypoxia.
21163096 2010 [Association of abnormal lipid metabolism with INSIG2 gene variant in overweight and obese children].
20955599 2010 The INSIG2 rs7566605 polymorphism is not associated with body mass index and breast cancer risk.
20920244 2010 Association of an INSIG2 obesity allele with cardiovascular phenotypes is gender and age dependent.
20877301 2012 Gene-gene interactions of the INSIG1 and INSIG2 in metabolic syndrome in schizophrenic patients treated with atypical antipsychotics.
20858904 2010 Fine mapping of the insulin-induced gene 2 identifies a variant associated with LDL cholesterol and total apolipoprotein B levels.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20816152 2010 Obesity and diabetes genetic variants associated with gestational weight gain.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20653998 2010 INSIG2 promoter variant, obesity markers and lipid parameters - No association in a large Slavonic Caucasian population sample.
20645959 2010 An INSIG2 polymorphism affects glucose homeostasis in Sardinian obese children and adolescents.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20538960 2010 A candidate gene study of obstructive sleep apnea in European Americans and African Americans.
20504252 2010 Association of HTR2C, but not LEP or INSIG2, genes with antipsychotic-induced weight gain in a German sample.
20373477 2010 Association study of polymorphisms in insulin induced gene 2 (INSIG2) with antipsychotic-induced weight gain in European and African-American schizophrenia patients.
20145255 2010 Characterization of the human insulin-induced gene 2 (INSIG2) promoter: the role of Ets-binding motifs.
20092643 2010 Large effects on body mass index and insulin resistance of fat mass and obesity associated gene (FTO) variants in patients with polycystic ovary syndrome (PCOS).
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
20068067 2010 The TRC8 ubiquitin ligase is sterol regulated and interacts with lipid and protein biosynthetic pathways.
20045156 2010 Common INSIG2 polymorphisms are associated with age-related changes in body size and high-density lipoprotein cholesterol from young adulthood to middle age.
20028541 2009 A tagging SNP in INSIG2 is associated with obesity-related phenotypes among Samoans.
20007308 2010 Influence of common variants near INSIG2, in FTO, and near MC4R genes on overweight and the metabolic profile in adolescence: the TRAILS (TRacking Adolescents' Individual Lives Survey) Study.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851442 2009 Meta-analysis of the INSIG2 association with obesity including 74,345 individuals: does heterogeneity of estimates relate to study design?
19772594 2009 Association analyses of the INSIG2 polymorphism in the obesity and cholesterol levels of Korean populations.
19740467 2010 Interactions among genetic variants from SREBP2 activating-related pathway on risk of coronary heart disease in Chinese Han population.
19638338 2009 Insig-mediated, sterol-accelerated degradation of the membrane domain of hamster 3-hydroxy-3-methylglutaryl-coenzyme A reductase in insect cells.
19523229 2009 The INSIG2 rs7566605 genetic variant does not play a major role in obesity in a sample of 24,722 individuals from four cohorts.
19399648 2009 Possible role for ENPP1 polymorphism in obesity but not for INSIG2 and PLIN variants.
19360016 2009 INSIG2 SNPs associated with obesity and glucose homeostasis traits in Hispanics: the IRAS Family Study.
19263810 2008 Association of the common genetic variant upstream of INSIG2 gene with obesity related phenotypes in Chinese children and adolescents.
19224890 2009 Aggravating effect of INSIG2 and FTO on overweight reduction in a one-year lifestyle intervention.
19197262 2009 Absence of association between the INSIG2 gene polymorphism (rs7566605) and obesity in the European Youth Heart Study (EYHS).
19197259 2009 Lack of association between a common polymorphism near the INSIG2 gene and BMI, myocardial infarction, and cardiovascular risk factors.
19105843 2008 INSIG2 gene polymorphism is associated with increased subcutaneous fat in women and poor response to resistance training in men.
18989534 2008 The INSIG1 gene, not the INSIG2 gene, associated with coronary heart disease: tagSNPs and haplotype-based association study. The Beijing Atherosclerosis Study.
18839134 2008 Assessing gene-treatment interactions at the FTO and INSIG2 loci on obesity-related traits in the Diabetes Prevention Program.
18682847 2008 Non-replication of genome-wide based associations between common variants in INSIG2 and PFKP and obesity in studies of 18,014 Danes.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18615239 2008 INSIG2 gene rs7566605 polymorphism is associated with severe obesity in Japanese.
18570692 2009 The single nucleotide polymorphism upstream of insulin-induced gene 2 ( INSIG2) is associated with the prevalence of hypercholesterolaemia, but not with obesity, in Japanese American women.
18514965 2008 A common polymorphism is associated with body mass index in Uyghur population.
18464289 2008 Insig2 is associated with colon tumorigenesis and inhibits Bax-mediated apoptosis.
18426866 2008 Association of FTO with obesity-related traits in the Cebu Longitudinal Health and Nutrition Survey (CLHNS) Cohort.
18398047 2008 Single nucleotide polymorphisms in obesity-related genes and the risk of esophageal cancers.
18347269 2008 Association of morbid obesity with FTO and INSIG2 allelic variants.
18319320 2008 Insulin-induced gene 2 involvement in human adipocyte metabolism and body weight regulation.
18270535 2008 Potential association of INSIG2 rs7566605 polymorphism with body weight in a Chinese subpopulation.
18239574 2008 INSIG2 polymorphism is neither associated with BMI nor with phenotypes of lipoprotein metabolism.
18223638 2008 No association between INSIG2 Gene rs7566605 polymorphism and being overweight in Japanese population.
18195716 2009 Association between the insulin-induced gene 2 (INSIG2) and weight gain in a German sample of antipsychotic-treated schizophrenic patients: perturbation of SREBP-controlled lipogenesis in drug-related metabolic adverse effects?
18162505 2008 Identification and replication of a novel obesity locus on chromosome 1q24 in isolated populations of Cilento.
18070740 2007 No association between rs7566605 variant and being overweight in Japanese.
18003761 2008 Evidence of an influence of a polymorphism near the INSIG2 on weight loss during a lifestyle intervention in obese children and adolescents.
17489846 2007 The common genetic variant upstream of INSIG2 gene is not associated with obesity in Indian population.
17471297 2007 INSIG2 gene polymorphism is not associated with obesity in Caucasian, Afro-Caribbean and Indian subjects.
17465681 2007 The association of a SNP upstream of INSIG2 with body mass index is reproduced in several but not all cohorts.
17428920 2007 Sterol-regulated transport of SREBPs from endoplasmic reticulum to Golgi: oxysterols block transport by binding to Insig.
17137505 2006 INSIG-2 promoter polymorphism and obesity related phenotypes: association study in 1428 members of 248 families.
16614226 2006 A common genetic variant is associated with adult and childhood obesity.
16606821 2006 Juxtamembranous aspartic acid in Insig-1 and Insig-2 is required for cholesterol homeostasis.
16549805 2006 Proteasomal degradation of ubiquitinated Insig proteins is determined by serine residues flanking ubiquitinated lysines.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12842885 2003 Reconstitution of sterol-regulated endoplasmic reticulum-to-Golgi transport of SREBP-2 in insect cells by co-expression of mammalian SCAP and Insigs.
12624180 2003 Liver-specific mRNA for Insig-2 down-regulated by insulin: implications for fatty acid synthesis.
12482938 2002 Three mutations in sterol-sensing domain of SCAP block interaction with insig and render SREBP cleavage insensitive to sterols.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242332 2002 Insig-2, a second endoplasmic reticulum protein that binds SCAP and blocks export of sterol regulatory element-binding proteins.