Property Summary

NCBI Gene PubMed Count 49
PubMed Score 177.28
PubTator Score 79.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.600 2.4e-07
psoriasis -1.900 1.2e-05
osteosarcoma 1.544 1.6e-04
atypical teratoid / rhabdoid tumor 1.100 9.0e-04
glioblastoma 1.600 7.8e-04
medulloblastoma, large-cell 1.600 6.2e-05
Atopic dermatitis -1.700 9.2e-03
tuberculosis -2.400 2.4e-06
pancreatic ductal adenocarcinoma liver m... -3.036 1.4e-05
Hydrolethalus syndrome -1.778 2.9e-02
lung cancer -2.100 3.2e-04
active Crohn's disease 2.769 5.0e-04
active ulcerative colitis 2.099 1.5e-03
non primary Sjogren syndrome sicca 1.100 2.1e-02
Breast cancer 1.300 6.7e-07
lung carcinoma -1.200 7.0e-14
spina bifida -2.269 3.9e-02
Pick disease -1.300 3.3e-04
gastric carcinoma -1.500 3.4e-02
ovarian cancer -1.100 1.0e-03
chronic rhinosinusitis -1.383 2.4e-02

Protein-protein Interaction (3)

Gene RIF (36)

PMID Text
25028659 identified interaction of three genes in INSIG-SCAP-SREBP pathway on risk of obesity, revealing that these genes affect obesity more likely through a complex interaction pattern than single gene effect.
24484994 Our results indicated that the dysregulation of INSIG1 and SREBF1 caused by ART were observed not only in the fetus but also in the placenta, primarily in the ICSI group
24371122 Data show the essential role of PPARgamma and PPARgamma coactivator 1alpha (PGC-1alpha) in up-regulating Insig-1/2 expression, defining a mechanistic pathway triggered by CD36, and leading to cholesterol depletion in hepatocytes.
23333304 HIV-1 Vif upregulates the expression of insulin induced gene 1 (INSIG1) in Vif-expression T cells
20877301 No significant associations were found between polymorphisms of INSIG1 gene and metabolic syndrome; however, INSIG1 and INSIG2 interactions were found in the significant 3-locus and 4-locus gene-gene interaction models.
20877301 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20444954 Common variation in INSIG1 is unlikely to have a major effect on risk of type 2 diabetes risk in white Europeans.
20444954 Observational study of gene-disease association. (HuGE Navigator)
19965593 From genetic association studies, SNPs in INSIG1 (including the promoter region) influence hypertriglyceridemia.
19965593 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19815544 These data suggest that p97 recruits proteasomes to polytopic ER proteins, such as Insig-1, even before they are extracted from membranes.
19740467 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19638338 Studies define Insig-1 and Insig-2 as the minimal requirement for sterol-accelerated degradation of the membrane domain of reductase.
18989534 The INSIG1 gene, not the INSIG2 gene, associated with coronary heart disease: tagSNPs and haplotype-based association study.
18989534 Observational study of gene-disease association. (HuGE Navigator)
18835813 Unsaturated fatty acid-mediated stabilization of Insig-1 enhances the ability of sterols to inhibit proteolytic activation of SREBP-1, which activates transcription of genes involved in fatty acid synthesis
18660489 Observational study of gene-disease association. (HuGE Navigator)
18195716 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18187584 Activation of CAR and PXR in mouse liver results in activation of Insig-1 along with reduced protein levels of the active form of sterol regulatory element binding protein 1 (Srebp-1).
17106696 Population studies demonstrate that INSIG1 plays a role in glucose homeostasis.
17043353 Insig-1 sterol-regulated degradation is mediated by the membrane-bound ubiquitin ligase gp78
16606821 These studies identify a aspartic acid residue that is crucial for the function of Insig1 and Insig2 proteins in regulating cholesterol homeostasis in mammalian cells.
16549805 degradation of ubiquitinated Insigs is controlled by serine residues flanking the sites of ubiquitination
16399501 Under conditions of mild steroid depletion, the failure to ubiquinate Insig-1 causes a delay in release of the Scap/sterol regulatory element binding protein-2, but it does not abolish it.
16168377 Results identify gp78 as the E3 that initiates sterol-accelerated degradation of reductase, and Insig-1 as a bridge between gp78/VCP and the reductase substrate.
15899885 Insig is required for sterol-mediated inhibition of Scap/SREBP binding to COPII proteins in vitro
15304479 Insig-1 has a role in activation of sterol regulatory element-binding protein induced by cellular stress
15247248 Insig-1 has a role in feedback control of lipid synthesis in cultured cells
15085196 nSREBPs are essential for high levels of lipid synthesis in the liver and indicate that Insig's modulate nSREBP levels by binding and retaining SCAP in the ER.
14660594 data indicate that short segments at the N and C termini of insulin induced gene 1(Insig-1) face the cytosol with most of the protein buried within the membrane, forming six transmembrane segments
12869692 insig-1 expression restricts lipogenesis in mature adipocytes and blocks differentiation in preadipocytes
12535518 Data show that Insig-1 appears to play an essential role in the sterol-mediated trafficking of two proteins with sterol-sensing domains, HMG CoA reductase and SCAP.
12242342 INSIG-1 plays a role in regulating cholesterol concentration in human cells
12115587 INSIG1 and p41 Arp2/3 complex (p41-Arc)reduced expression might be involved in gastric cancer development or progression

AA Sequence

MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGP      1 - 70
EPGSPYPNTWHHRLLQRSLVLFSVGVVLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVV     71 - 140
GLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSG    141 - 210
LGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD       211 - 277
//

Text Mined References (50)

PMID Year Title
27198006 2016 Statin-induced expression change of INSIG1 in lymphoblastoid cell lines correlates with plasma triglyceride statin response in a sex-specific manner.
25028659 2014 The gene-gene interaction of INSIG-SCAP-SREBP pathway on the risk of obesity in Chinese children.
24662972 2014 Genome-wide interaction study of smoking and bladder cancer risk.
24484994 2014 Assisted reproductive technologies impair the expression and methylation of insulin-induced gene 1 and sterol regulatory element-binding factor 1 in the fetus and placenta.
24371122 2014 Scavenger receptor CD36 mediates inhibition of cholesterol synthesis via activation of the PPAR?/PGC-1? pathway and Insig1/2 expression in hepatocytes.
23919961 2013 Adaptive changes of the Insig1/SREBP1/SCD1 set point help adipose tissue to cope with increased storage demands of obesity.
22648509 2012 PKNOX2 is associated with formal thought disorder in schizophrenia: a meta-analysis of two genome-wide association studies.
21343306 2011 Membrane-associated ubiquitin ligase complex containing gp78 mediates sterol-accelerated degradation of 3-hydroxy-3-methylglutaryl-coenzyme A reductase.
21081644 2011 Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase.
20877301 2012 Gene-gene interactions of the INSIG1 and INSIG2 in metabolic syndrome in schizophrenic patients treated with atypical antipsychotics.
20817058 2010 Insulin-induced gene: a new regulator in lipid metabolism.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20444954 2010 No association between polymorphisms in the INSIG1 gene and the risk of type 2 diabetes and related traits.
20068067 2010 The TRC8 ubiquitin ligase is sterol regulated and interacts with lipid and protein biosynthetic pathways.
19965593 2010 INSIG1 influences obesity-related hypertriglyceridemia in humans.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19815544 2009 Regulated endoplasmic reticulum-associated degradation of a polytopic protein: p97 recruits proteasomes to Insig-1 before extraction from membranes.
19740467 2010 Interactions among genetic variants from SREBP2 activating-related pathway on risk of coronary heart disease in Chinese Han population.
19638338 2009 Insig-mediated, sterol-accelerated degradation of the membrane domain of hamster 3-hydroxy-3-methylglutaryl-coenzyme A reductase in insect cells.
18989534 2008 The INSIG1 gene, not the INSIG2 gene, associated with coronary heart disease: tagSNPs and haplotype-based association study. The Beijing Atherosclerosis Study.
18835813 2008 Unsaturated fatty acids inhibit proteasomal degradation of Insig-1 at a postubiquitination step.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18195716 2009 Association between the insulin-induced gene 2 (INSIG2) and weight gain in a German sample of antipsychotic-treated schizophrenic patients: perturbation of SREBP-controlled lipogenesis in drug-related metabolic adverse effects?
18187584 2008 Regulatory cross-talk between drug metabolism and lipid homeostasis: constitutive androstane receptor and pregnane X receptor increase Insig-1 expression.
17106696 2007 Human evidence for the involvement of insulin-induced gene 1 in the regulation of plasma glucose concentration.
17043353 2006 Sterol-regulated degradation of Insig-1 mediated by the membrane-bound ubiquitin ligase gp78.
16606821 2006 Juxtamembranous aspartic acid in Insig-1 and Insig-2 is required for cholesterol homeostasis.
16549805 2006 Proteasomal degradation of ubiquitinated Insig proteins is determined by serine residues flanking ubiquitinated lysines.
16399501 2006 Sterol-regulated ubiquitination and degradation of Insig-1 creates a convergent mechanism for feedback control of cholesterol synthesis and uptake.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16168377 2005 Gp78, a membrane-anchored ubiquitin ligase, associates with Insig-1 and couples sterol-regulated ubiquitination to degradation of HMG CoA reductase.
15899885 2005 Insig required for sterol-mediated inhibition of Scap/SREBP binding to COPII proteins in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304479 2004 Proteolytic activation of sterol regulatory element-binding protein induced by cellular stress through depletion of Insig-1.
15247248 2004 Isolation of mutant cells lacking Insig-1 through selection with SR-12813, an agent that stimulates degradation of 3-hydroxy-3-methylglutaryl-coenzyme A reductase.
15085196 2004 Overexpression of Insig-1 in the livers of transgenic mice inhibits SREBP processing and reduces insulin-stimulated lipogenesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660594 2004 Membrane topology of human insig-1, a protein regulator of lipid synthesis.
12963821 2003 Cholesterol-induced conformational change in SCAP enhanced by Insig proteins and mimicked by cationic amphiphiles.
12869692 2003 Insig-1 "brakes" lipogenesis in adipocytes and inhibits differentiation of preadipocytes.
12842885 2003 Reconstitution of sterol-regulated endoplasmic reticulum-to-Golgi transport of SREBP-2 in insect cells by co-expression of mammalian SCAP and Insigs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12535518 2003 Accelerated degradation of HMG CoA reductase mediated by binding of insig-1 to its sterol-sensing domain.
12482938 2002 Three mutations in sterol-sensing domain of SCAP block interaction with insig and render SREBP cleavage insensitive to sterols.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242342 2002 The hypocholesterolemic agent LY295427 up-regulates INSIG-1, identifying the INSIG-1 protein as a mediator of cholesterol homeostasis through SREBP.
12242332 2002 Insig-2, a second endoplasmic reticulum protein that binds SCAP and blocks export of sterol regulatory element-binding proteins.
12202038 2002 Crucial step in cholesterol homeostasis: sterols promote binding of SCAP to INSIG-1, a membrane protein that facilitates retention of SREBPs in ER.
12115587 2002 Reduced expression of the insulin-induced protein 1 and p41 Arp2/3 complex genes in human gastric cancers.
9268630 1997 Cloning, human chromosomal assignment, and adipose and hepatic expression of the CL-6/INSIG1 gene.