Property Summary

NCBI Gene PubMed Count 22
PubMed Score 7.72
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Gene RIF (5)

AA Sequence

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQASALSLSS      1 - 70
STSTWPEGLDATARAPPALVVTANIGQAGGSSSRQFRQRALGTSDSPVLFIHCPGAAGTAQGLEYRGRRV     71 - 140
TTELVWEEVDSSPQPQGSESLPAQPPAQPAPQPEPQQAREPSPEVSCCGLWPRRPQRSQN              141 - 200
//

Text Mined References (23)

PMID Year Title