Property Summary

NCBI Gene PubMed Count 817
PubMed Score 146933.74
PubTator Score 51392.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
diabetes mellitus 1728 9.762 4.0
Hypoglycemia 152 8.828 4.0
Hyperglycemia 137 8.538 4.0
Obesity 678 8.349 4.0
Hyperinsulinism 133 8.223 4.0
Polycystic ovary syndrome 360 7.192 3.6
Hypertension 396 6.938 3.5
Pancreatitis 123 5.341 2.7
Hypokalemia 52 4.251 2.1
Acute kidney injury 70 0.0 0.0
Albuminuria 21 0.0 0.0
Alzheimer Disease 83 0.0 0.0
Bipolar Disorder 666 0.0 0.0
Cardiomyopathy, Hypertrophic 24 0.0 0.0
DIABETES MELLITUS, INSULIN-DEPENDENT, 2 1 0.0 0.0
DIABETES MELLITUS, PERMANENT NEONATAL 5 0.0 0.0
Diabetes Mellitus, Type 1 43 0.0 0.0
Diabetes Mellitus, Type 2 142 0.0 0.0
Diabetic Cardiomyopathies 10 0.0 0.0
Diabetic Nephropathies 37 0.0 0.0
Edema 81 0.0 0.0
Fatty Liver 70 0.0 0.0
Glucose Intolerance 19 0.0 0.0
Heart Arrest 3 0.0 0.0
Heart failure 162 0.0 0.0
Hepatitis 67 0.0 0.0
Hyperkalemia 17 0.0 0.0
Hyperproinsulinemia 1 0.0 0.0
Hypertriglyceridemia 17 0.0 0.0
Hypotension 82 0.0 0.0
Insulin Resistance 72 0.0 0.0
Kidney Diseases, Cystic 6 0.0 0.0
Lewy Body Disease 21 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Liver Failure, Acute 29 0.0 0.0
MPTP Poisoning 1 0.0 0.0
Maturity-Onset Diabetes of the Young, Type 10 2 0.0 0.0
Memory Disorders 40 0.0 0.0
Metabolic Diseases 10 0.0 0.0
Metabolic Syndrome 20 0.0 0.0
Micronuclei, Chromosome-Defective 25 0.0 0.0
Muscular Diseases 27 0.0 0.0
Neural Tube Defects 31 0.0 0.0
Neurocognitive Disorders 1 0.0 0.0
Panic disorder 61 0.0 0.0
Paralysis 9 0.0 0.0
Paresthesia 32 0.0 0.0
Parkinson Disease 64 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Renal Insufficiency 90 0.0 0.0
Rhabdomyolysis 15 0.0 0.0
Seizures 596 0.0 0.0
Tachycardia 43 0.0 0.0
Telomeric 22q13 Monosomy Syndrome 2 0.0 0.0
Urinary Bladder Diseases 5 0.0 0.0
Ventricular Dysfunction, Left 22 0.0 0.0
Ventricular Fibrillation 17 0.0 0.0
Ventricular Outflow Obstruction 1 0.0 0.0
Weight Loss 24 0.0 0.0
diabetic ketoacidosis 3 0.0 0.0
Disease Target Count
Neuropathy 261
Alzheimer's disease 658
Metabolic syndrome X 52
Myopathy 185
Abnormality of the immune system 18
Anteverted nostril 191
Arthrogryposis 54
Axial hypotonia 46
Beta-cell dysfunction 5
Bilateral ptosis 9
Blepharoptosis 231
Cardiac arrest 36
Cognitive delay 608
Congenital Heart Defects 58
Congenital clinodactyly 57
Congenital ear anomaly NOS (disorder) 29
Congenital heart disease 93
Contracture of lower limb 6
Curvature of digit 57
Cystic Kidney Diseases 6
Dehydration 40
Diabetes Mellitus, Insulin-Dependent 48
Diabetes Mellitus, Non-Insulin-Dependent 145
Diabetic Nephropathy 34
Downturned corners of mouth 48
Epilepsies, Myoclonic 32
Epilepsy 792
Failure to gain weight 365
Fetal Growth Retardation 189
Generalized myoclonic seizures 30
Global developmental delay 608
Glycosuria 29
High urine albumin levels 5
Hypertensive disease 292
Hypertrophic Cardiomyopathy 117
Hypovolemia 8
Hypsarrhythmia 25
Impaired glucose tolerance 28
Infant, Small for Gestational Age 176
Intrauterine retardation 176
Ketoacidosis 11
Ketonuria 8
Limb contractures 6
Long philtrum 137
Low Birth Weights 69
Maturity onset diabetes mellitus in young 11
Mental and motor retardation 608
Microalbuminuria 5
Motor delay 147
Muscle Weakness 170
Myoclonic Epilepsies, Progressive 44
Neonatal insulin-dependent diabetes mellitus 6
No development of motor milestones 147
Paralysed 42
Pediatric failure to thrive 365
Peripheral Neuropathy 134
Prominent metopic ridge 15
Radially deviated fingers 38
Reduced pancreatic beta cells 6
Retinal Diseases 55
Short nose 132
Small for gestational age (disorder) 69
Small nose 132
Tonic - clonic seizures 44
Unipolar Depression 250
Weight decreased 103
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 109 0.0 5.0
Disease Target Count Z-score Confidence
Lipid metabolism disorder 114 6.619 3.3
Coronary artery disease 268 6.268 3.1
Kidney disease 430 6.207 3.1
Hyperandrogenism 34 6.109 3.1
Fatty liver disease 103 5.965 3.0
Acanthosis Nigricans 27 5.954 3.0
Atherosclerosis 291 5.953 3.0
Adenoma 167 5.739 2.9
Hyperinsulinemic hypoglycemia 17 5.635 2.8
Cancer 2499 5.536 2.8
Diabetic retinopathy 56 5.515 2.8
Lipodystrophy 40 5.419 2.7
Heart disease 306 5.341 2.7
Anovulation 21 5.289 2.6
Autonomic neuropathy 22 5.184 2.6
Liver disease 237 5.16 2.6
Cerebrovascular disease 238 5.07 2.5
Lactic acidosis 51 5.052 2.5
Acromegaly 51 4.982 2.5
Hypersensitivity reaction type II disease 253 4.923 2.5
Donohue syndrome 6 4.739 2.4
Hypothyroidism 122 4.738 2.4
Hypopituitarism 40 4.701 2.4
Eating disorder 26 4.494 2.2
Hyperthyroidism 53 4.383 2.2
Infertility 188 4.383 2.2
Allergic hypersensitivity disease 126 4.339 2.2
Brain disease 96 4.267 2.1
Cushing's syndrome 48 4.208 2.1
Duodenal ulcer 20 4.204 2.1
Peripheral vascular disease 87 4.198 2.1
Hypogonadism 173 4.19 2.1
Amenorrhea 58 4.114 2.1
Hyperuricemia 49 4.097 2.0
Obstructive sleep apnea 26 4.063 2.0
cystic fibrosis 1696 3.942 2.0
Schizophrenia 1160 3.915 2.0
Dementia 175 3.9 1.9
Dumping syndrome 8 3.881 1.9
Diarrhea 253 3.813 1.9
Osteoporosis 363 3.713 1.9
Blindness 88 3.628 1.8
Thyrotoxicosis 38 3.618 1.8
Prader-Willi syndrome 48 3.588 1.8
Hyperprolactinemia 27 3.575 1.8
Lung disease 142 3.572 1.8
Gastroparesis 22 3.528 1.8
Anemia 365 3.407 1.7
Impotence 42 3.369 1.7
Addison's disease 31 3.333 1.7
Arthritis 290 3.284 1.6
Hepatitis C 94 3.278 1.6
Glycogen storage disease 39 3.255 1.6
protein-energy malnutrition 8 3.241 1.6
Pituitary adenoma 38 3.223 1.6
Cataract 297 3.204 1.6
Steatorrhea 34 3.195 1.6
Wolfram syndrome 12 3.186 1.6
Macular retinal edema 13 3.16 1.6
Hyperparathyroidism 48 3.145 1.6
ADULT syndrome 9 3.11 1.6
Exocrine pancreatic insufficiency 32 3.106 1.6
Polyneuropathy 64 3.032 1.5
Mood disorder 14 3.013 1.5
Craniopharyngioma 16 3.005 1.5

Expression

See source...

PDB (245)

Gene RIF (735)

AA Sequence

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG      1 - 70
GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN                                   71 - 110
//

Text Mined References (817)

PMID Year Title