Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.89
PubTator Score 33.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2714 3.1e-15
psoriasis 6685 2.1e-05

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.200 2.1e-05
lung adenocarcinoma -1.400 3.1e-15

Synonym

Accession Q9BT40 B2R6I2 B2R750 D3DTH8 Q15733 Q9NPJ5 Q9P2R5
Symbols PPS
SKIP

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
25241900 Study reveals that SKIP is a significant regulator of glioblastoma cell migration and that increased expression of SKIP may confer a survival advantage.
22815484 SKIP controls the IGF-II-PI 3-kinase-Akt-mTOR auto-regulation loop during myogenesis.
22751929 Specific suppression of insulin signaling is achieved via the spatiotemporal regulation of SKIP through the scaffolding function of Pak1.
18774950 The authors report that HBV core protein interacts with a cellular SKIP (skeletal muscle and kidney enriched inositol phosphatase) protein, an endoplasmic reticulum-located phosphoinositide 5-phosphatase, both in vivo and in vitro.
12536145 identification of novel domain that mediates membrane ruffle localization

AA Sequence

MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFND      1 - 70
SWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYG     71 - 140
YYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIK    141 - 210
NRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPC    211 - 280
AGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYS    281 - 350
STSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR    351 - 420
SVVGISRPFQIPPGSLREDPLGEAQPQI                                              421 - 448
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25241900 2015 Differential SKIP expression in PTEN-deficient glioblastoma regulates cellular proliferation and migration.
22815484 2012 Role of phosphatidylinositol 3,4,5-trisphosphate (PIP3) 5-phosphatase skeletal muscle- and kidney-enriched inositol polyphosphate phosphatase (SKIP) in myoblast differentiation.
22751929 2012 Regulation of insulin signaling by the phosphatidylinositol 3,4,5-triphosphate phosphatase SKIP through the scaffolding function of Pak1.
21712384 2011 Silencer of death domains (SODD) inhibits skeletal muscle and kidney enriched inositol 5-phosphatase (SKIP) and regulates phosphoinositide 3-kinase (PI3K)/Akt signaling to the actin cytoskeleton.
19946888 2010 Defining the membrane proteome of NK cells.
18774950 2009 Suppression of hepatitis B viral gene expression by phosphoinositide 5-phosphatase SKIP.
18573875 2008 Increased insulin action in SKIP heterozygous knockout mice.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16002321 2005 Characterization of human LNX, a novel ligand of Numb protein X that is downregulated in human gliomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12621583 2003 Refinement of a 400-kb critical region allows genotypic differentiation between isolated lissencephaly, Miller-Dieker syndrome, and other phenotypes secondary to deletions of 17p13.3.
12556481 2003 SKIP negatively regulates insulin-induced GLUT4 translocation and membrane ruffle formation.
12536145 2003 Identification of a novel domain in two mammalian inositol-polyphosphate 5-phosphatases that mediates membrane ruffle localization. The inositol 5-phosphatase skip localizes to the endoplasmic reticulum and translocates to membrane ruffles following epidermal growth factor stimulation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10753883 2000 Identification and characterization of a novel inositol polyphosphate 5-phosphatase.
8968500 1996 The family of inositol and phosphatidylinositol polyphosphate 5-phosphatases.
8968499 1996 Regulation of second messengers by the inositol polyphosphate 5-phosphatases.