Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.95
PubTator Score 18.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
chronic lymphocytic leukemia 2.924 1.8e-07
malignant mesothelioma 1.700 2.5e-07
astrocytic glioma -2.500 3.6e-03
ependymoma -3.200 4.8e-03
oligodendroglioma -1.800 3.4e-02
glioblastoma -2.200 2.5e-04
sonic hedgehog group medulloblastoma -2.700 1.8e-08
atypical teratoid / rhabdoid tumor -2.300 2.0e-06
medulloblastoma, large-cell -3.600 1.4e-06
primitive neuroectodermal tumor -1.500 7.1e-04
active Crohn's disease 1.099 1.3e-02
adult high grade glioma -2.600 1.1e-07
pilocytic astrocytoma 1.300 1.8e-05
aldosterone-producing adenoma -1.246 1.8e-02
Pick disease -1.600 1.3e-02
ovarian cancer -2.100 7.0e-08
pituitary cancer -1.100 1.9e-03

 GWAS Trait (1)

Gene RIF (6)

PMID Text
26430724 we identified inositol polyphosphate-5-phosphatase F (INPP5F) as a prognostic factor for progression-free survival in Chronic lymphocytic leukemia
25869669 Sac2 colocalizes with early endosomal markers and is recruited to transferrin-containing vesicles during endocytic recycling.
25476455 These findings suggest that INPP5F is a potential tumor suppressor in gliomas via inhibition of STAT3 pathway, and that deregulation of INPP5F may lead to contribution to gliomagenesis.
19875726 Inpp5f is a polyphosphoinositide phosphatase that regulates cardiac hypertrophic responsiveness.
19460752 Knockdown of inositol polyphosphate-5-phosphatase F (INPP5F) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MELFQAKDHYILQQGERALWCSRRDGGLQLRPATDLLLAWNPICLGLVEGVIGKIQLHSDLPWWLILIRQ      1 - 70
KALVGKLPGDHEVCKVTKIAVLSLSEMEPQDLELELCKKHHFGINKPEKIIPSPDDSKFLLKTFTHIKSN     71 - 140
VSAPNKKKVKESKEKEKLERRLLEELLKMFMDSESFYYSLTYDLTNSVQRQSTGERDGRPLWQKVDDRFF    141 - 210
WNKYMIQDLTEIGTPDVDFWIIPMIQGFVQIEELVVNYTESSDDEKSSPETPPQESTCVDDIHPRFLVAL    211 - 280
ISRRSRHRAGMRYKRRGVDKNGNVANYVETEQLIHVHNHTLSFVQTRGSVPVFWSQVGYRYNPRPRLDRS    281 - 350
EKETVAYFCAHFEEQLNIYKKQVIINLVDQAGREKIIGDAYLKQVLLFNNSHLTYVSFDFHEHCRGMKFE    351 - 420
NVQTLTDAIYDIILDMKWCWVDEAGVICKQEGIFRVNCMDCLDRTNVVQAAIARVVMEQQLKKLGVMPPE    421 - 490
QPLPVKCNRIYQIMWANNGDSISRQYAGTAALKGDFTRTGERKLAGVMKDGVNSANRYYLNRFKDAYRQA    491 - 560
VIDLMQGIPVTEDLYSIFTKEKEHEALHKENQRSHQELISQLLQSYMKLLLPDDEKFHGGWALIDCDPSL    561 - 630
IDATHRDVDVLLLLSNSAYYVAYYDDEVDKVNQYQRLSLENLEKIEIGPEPTLFGKPKFSCMRLHYRYKE    631 - 700
ASGYFHTLRAVMRNPEEDGKDTLQCIAEMLQITKQAMGSDLPIIEKKLERKSSKPHEDIIGIRSQNQGSL    701 - 770
AQGKNFLMSKFSSLNQKVKQTKSNVNIGNLRKLGNFTKPEMKVNFLKPNLKVNLWKSDSSLETMENTGVM    771 - 840
DKVQAESDGDMSSDNDSYHSDEFLTNSKSDEDRQLANSLESVGPIDYVLPSCGIIASAPRLGSRSQSLSS    841 - 910
TDSSVHAPSEITVAHGSGLGKGQESPLKKSPSAGDVHILTGFAKPMDIYCHRFVQDAQNKVTHLSETRSV    911 - 980
SQQASQERNQMTNQVSNETQSESTEQTPSRPSQLDVSLSATGPQFLSVEPAHSVASQKTPTSASSMLELE    981 - 1050
TGLHVTPSPSESSSSRAVSPFAKIRSSMVQVASITQAGLTHGINFAVSKVQKSPPEPEIINQVQQNELKK   1051 - 1120
MFIQCQTRIIQI                                                             1121 - 1132
//

Text Mined References (24)

PMID Year Title
26430724 2015 Gene expression of INPP5F as an independent prognostic marker in fludarabine-based therapy of chronic lymphocytic leukemia.
26203138 2015 Gene-Silencing Screen for Mammalian Axon Regeneration Identifies Inpp5f (Sac2) as an Endogenous Suppressor of Repair after Spinal Cord Injury.
25869669 2015 Spatiotemporal control of phosphatidylinositol 4-phosphate by Sac2 regulates endocytic recycling.
25869668 2015 Sac2/INPP5F is an inositol 4-phosphatase that functions in the endocytic pathway.
25476455 2014 Inositol Polyphosphate-5-Phosphatase F (INPP5F) inhibits STAT3 activity and suppresses gliomas tumorigenicity.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19875726 2009 Inpp5f is a polyphosphoinositide phosphatase that regulates cardiac hypertrophic responsiveness.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18281508 2008 Root hair defective4 encodes a phosphatidylinositol-4-phosphate phosphatase required for proper root hair development in Arabidopsis thaliana.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17322895 2007 Hdac2 regulates the cardiac hypertrophic response by modulating Gsk3 beta activity.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12805586 2003 The SAC domain-containing protein gene family in Arabidopsis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11274189 2001 Identification and characterization of a sac domain-containing phosphoinositide 5-phosphatase.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.