Property Summary

Ligand Count 1
NCBI Gene PubMed Count 15
PubMed Score 19.30
PubTator Score 16.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.900 5.8e-03
astrocytoma -1.100 3.6e-13
Astrocytoma, Pilocytic -1.200 1.4e-04
atypical teratoid / rhabdoid tumor -1.200 7.5e-05
colon cancer -1.400 3.1e-05
cutaneous lupus erythematosus -1.100 1.1e-02
glioblastoma -1.200 5.5e-03
group 3 medulloblastoma -1.100 3.2e-02
lung adenocarcinoma -1.300 9.5e-23
medulloblastoma, large-cell -2.300 9.9e-05
oligodendroglioma -1.100 1.4e-09
osteosarcoma 1.646 1.0e-03
ovarian cancer -1.400 2.5e-04
Pick disease -1.100 6.7e-04
spina bifida -1.270 3.7e-02
subependymal giant cell astrocytoma -2.836 1.8e-02
ulcerative colitis -1.200 4.7e-04

Protein-protein Interaction (3)

Gene RIF (2)

AA Sequence

MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDK      1 - 70
FVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTL     71 - 140
ESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKAL    141 - 210
GYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVMLQ    211 - 280
LEKKLFDYFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDR    281 - 350
ILMSPSAKELVLRSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGAGKPHAHVHKCCVVQ            351 - 412
//

Text Mined References (15)

PMID Year Title