Property Summary

NCBI Gene PubMed Count 40
PubMed Score 36.73
PubTator Score 33.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
astrocytic glioma -1.600 1.3e-02
posterior fossa group A ependymoma 3.400 2.2e-12
oligodendroglioma -1.300 2.8e-02
osteosarcoma -1.426 1.4e-02
glioblastoma -1.700 7.7e-05
group 4 medulloblastoma -2.400 6.2e-10
cystic fibrosis 2.177 1.6e-05
atypical teratoid/rhabdoid tumor 3.100 4.3e-05
medulloblastoma, large-cell -2.400 3.1e-07
acute quadriplegic myopathy 1.615 9.1e-07
tuberculosis and treatment for 3 months 3.200 1.7e-09
intraductal papillary-mucinous adenoma (... 1.900 1.9e-02
intraductal papillary-mucinous carcinoma... 1.800 2.1e-02
intraductal papillary-mucinous neoplasm ... 3.900 1.6e-03
lung cancer -2.200 5.4e-04
sarcoidosis -1.200 5.8e-05
pancreatic cancer 1.800 1.2e-04
fibroadenoma 1.400 1.4e-02
adult high grade glioma -1.900 1.1e-07
pilocytic astrocytoma -1.400 6.8e-06
Breast cancer -1.500 3.2e-03
ductal carcinoma in situ 1.400 2.9e-02
invasive ductal carcinoma 2.200 1.3e-03
ovarian cancer -1.800 1.8e-03

Synonym

Accession O15327 Q2TAI2 Q5XLE7 Q6IN59 Q6PJB4
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (30)

PMID Text
26700619 Studies indicate that phosphatidylinositol 4-phosphate phosphatase (INPP4B) that acting as tumor suppressors by antagonizing AKT signaling at endosomes.
26577950 The incidence of INPP4B loss of heterozygosity was significantly higher in the triple-negative breast tumor subtype and positively correlated with PTEN loss of heterozygosity.
26573229 Data show that activation of serum- and glucocorticoid-regulated kinase 3 (SGK3) plays an important role in inositol polyphosphate 4-phosphatase type II (INPP4B)-mediated melanoma cell proliferation.
26189250 Seventy-nine percent of the ovarian cancers demonstrated loss of INPP4B, most frequently in serous and endometrioid cancer subtypes.
25883023 Studies in human tissues suggest that reductions in INPP4B and PTEN co-occur in human thyroid and endometrial cancers. INPP4B may therefore be an important regulator of cancer progression, especially in the context of PTEN insufficiency.
25883022 Study provides evidence that INPP4B loss can promote follicular-like thyroid cancer progression and metastasis in the context of PTEN haploinsufficiency through the isoform-specific regulation of AKT signaling at the endosomes.
25868852 Given that INPP4B loss has been found in 40% of ovarian cancer patients, this study provides the rationale for establishing INPP4B as a biomarker of PARP inhibitor response.
25736313 A previously unsuspected and clinically relevant role for INPP4B gain of function as a mediator of chemoresistance and poor survival outcome in AML independent of its phosphoinositide phosphatase function.
25736236 INPP4B overexpression is associated with therapy resistance in acute myeloid leukemia
25542038 There were no significant associations of PIK3CA copy number, pAKt, or INPP4B with trastuzumab efficacy.
25528023 ). We find that RAD50 and INPP4B expression levels have a synergistic influence on breast cancer survival, possibly through their effects on treatment response.
25458846 Breast cancers harboring oncogenic PIK3CA activate SGK3 signaling while suppressing Akt, indicative of oncogenic functions for both INPP4B and SGK3 in these tumors.
25284366 INPP4B is highly expressed in intermediate cells within proliferative inflammatory atrophic ducts, and expression is reduced in prostate carcinoma
25277204 ERalpha plays a protective role in bladder cancer initiation and growth at least partly via modulating the INPP4B/Akt pathway.
25248616 INPP4B is a novel suppressor of oncogenic PKC signaling, further emphasizing the role of INPP4B in maintaining normal physiology of the prostate epithelium and suppressing metastatic potential of prostate tumors.
25129256 An association of an INPP4B polymorphism (rs13102150) with multiple sclerosis was observed
25126743 Epigenetic inactivation of INPP4B is one of the key mechanisms in activating PI3K/AKT signaling cascade and playing a role in the tumorigenesis of nasopharyngeal carcinoma.
24837011 the combination of INPP4B gene transfection and PARP inhibitor had a synergistic antitumor effect on PC3 cells
24591580 INPP4B, which dephosphorylates PI(3,4)P2 to PI(3)P, is essential for macropinocytosis.
24288008 INPP4B regulates PI3K/Akt signaling and exerts a tumor suppressor effect, impacting the proliferative, invasive, and tumorigenic capacity of melanoma cells.
24070612 INPP4B has protein phosphatase activity. different residues within the catalytic site of INPP4B are responsible for activity with lipid and protein substrates and for substrate specificity than for PTEN.
24051093 Codepletion of INPP4B and hexokinase 2 markedly sensitized radioresistant laryngeal cancer cells to irradiation or anticancer drug.
22895072 INPP4B depletion significantly attenuated radiation-induced increases in Akt phosphorylation.
22377302 Inositol phosphatase and bone mass: role of INPP4b.
21487159 INPP4B: the new kid on the PI3K block.
21127264 INPP4B functions as a tumor suppressor by negatively regulating normal and malignant mammary epithelial cell proliferation through regulation of the PI3K/Akt signaling pathway
21070662 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19647222 INPP4B has been identified as a tumor suppressor. Loss of heterozygosity (LOH) is found at the INPP4B locus in basal-like breast cancers, as well as in a significant fraction of ovarian cancers.
17846126 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLNTLVQISVIHP      1 - 70
VEQSLTRYSSTEIVEGTRDPLFLTGVTFPSEYPIYEETKIKLTVYDVKDKSHDTVRTSVLPEHKDPPPEV     71 - 140
GRSFLGYASFKVGELLKSKEQLLVLSLRTSDGGKVVGTIEVSVVKMGEIEDGEADHITTDVQGQKCALVC    141 - 210
ECTAPESVSGKDNLPFLNSVLKNPVCKLYRFPTSDNKWMRIREQMSESILSFHIPKELISLHIKEDLCRN    211 - 280
QEIKELGELSPHWDNLRKNVLTHCDQMVNMYQDILTELSKETGSSFKSSSSKGEKTLEFVPINLHLQRMQ    281 - 350
VHSPHLKDALYDVITVGAPAAHFQGFKNGGLRKLLHRFETERRNTGYQFIYYSPENTAKAKEVLSNINQL    351 - 420
QPLIATHADLLLNSASQHSPDSLKNSLKMLSEKTELFVHAFKDQLVRSALLALYTARPGGILKKPPSPKS    421 - 490
STEESSPQDQPPVMRGQDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNNDGEK    491 - 560
EPSLTDAIPSHPREDWYEQLYPLILTLKDCMGEVVNRAKQSLTFVLLQELAYSLPQCLMLTLRRDIVFSQ    561 - 630
ALAGLVCGFIIKLQTSLYDPGFLQQLHTVGLIVQYEGLLSTYSDEIGMLEDMAVGISDLKKVAFKIIEAK    631 - 700
SNDVLPVITGRREHYVVEVKLPARMFESLPLQIKEGQLLHVYPVLFNVGINEQQTLAERFGDVSLQESIN    701 - 770
QENFELLQEYYKIFMEKMPPDYISHFQEQNDLKALLENLLQNIQSKKRKNVEIMWLAATICRKLNGIRFT    771 - 840
CCKSAKDRTSMSVTLEQCSILRDEHQLHKDFFIRALDCMRREGCRIENVLKNIKCRKYAFNMLQLMAFPK    841 - 910
YYRPPEGTYGKADT                                                            911 - 924
//

Text Mined References (41)

PMID Year Title
26700619 2016 Endosome and INPP4B.
26577950 2016 Biological and clinical significance of loss of heterozygosity at the INPP4B gene locus in Japanese breast cancer.
26573229 2015 INPP4B is upregulated and functions as an oncogenic driver through SGK3 in a subset of melanomas.
26189250 2015 Prognostic value of INPP4B protein immunohistochemistry in ovarian cancer.
25883023 2015 INPP4B Is a PtdIns(3,4,5)P3 Phosphatase That Can Act as a Tumor Suppressor.
25883022 2015 In Vivo Role of INPP4B in Tumor and Metastasis Suppression through Regulation of PI3K-AKT Signaling at Endosomes.
25868852 2015 Loss of INPP4B causes a DNA repair defect through loss of BRCA1, ATM and ATR and can be targeted with PARP inhibitor treatment.
25736313 2015 Inositol polyphosphate 4-phosphatase II (INPP4B) is associated with chemoresistance and poor outcome in AML.
25736236 2015 INPP4B overexpression is associated with poor clinical outcome and therapy resistance in acute myeloid leukemia.
25542038 2014 An integrative analysis of PIK3CA mutation, PTEN, and INPP4B expression in terms of trastuzumab efficacy in HER2-positive breast cancer.
25528023 2015 INPP4B and RAD50 have an interactive effect on survival after breast cancer.
25458846 2014 SGK3 mediates INPP4B-dependent PI3K signaling in breast cancer.
25284366 2015 INPP4B is highly expressed in prostate intermediate cells and its loss of expression in prostate carcinoma predicts for recurrence and poor long term survival.
25277204 2014 Estrogen receptor alpha prevents bladder cancer via INPP4B inhibited akt pathway in vitro and in vivo.
25248616 2014 INPP4B suppresses prostate cancer cell invasion.
25129256 2014 Nerve conduction velocity is regulated by the inositol polyphosphate-4-phosphatase II gene.
25126743 2014 Epigenetic inactivation of inositol polyphosphate 4-phosphatase B (INPP4B), a regulator of PI3K/AKT signaling pathway in EBV-associated nasopharyngeal carcinoma.
24837011 2014 Effects of INPP4B gene transfection combined with PARP inhibitor on castration therapy-resistant prostate cancer cell line, PC3.
24591580 2014 Sequential breakdown of 3-phosphorylated phosphoinositides is essential for the completion of macropinocytosis.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
24288008 2014 A tumor suppressor function for the lipid phosphatase INPP4B in melanocytic neoplasms.
24070612 2013 Determinants of the tumor suppressor INPP4B protein and lipid phosphatase activities.
24051093 2013 INPP4B-mediated tumor resistance is associated with modulation of glucose metabolism via hexokinase 2 regulation in laryngeal cancer cells.
22895072 2012 Identification of inositol polyphosphate 4-phosphatase type II as a novel tumor resistance biomarker in human laryngeal cancer HEp-2 cells.
22377302 2012 [Inositol phosphatase and bone mass: role of INPP4b].
21487159 2011 INPP4B: the new kid on the PI3K block.
21127264 2010 Inositol polyphosphate 4-phosphatase II regulates PI3K/Akt signaling and is lost in human basal-like breast cancers.
21070662 2010 Schizophrenia and vitamin D related genes could have been subject to latitude-driven adaptation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19647222 2009 Evidence that inositol polyphosphate 4-phosphatase type II is a tumor suppressor that inhibits PI3K signaling.
17846126 2007 Identification of novel candidate genes for type 2 diabetes from a genome-wide association scan in the Old Order Amish: evidence for replication from diabetes-related quantitative traits and from independent populations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10097090 1999 The inositol polyphosphate 4-phosphatase forms a complex with phosphatidylinositol 3-kinase in human platelet cytosol.
9599410 1998 Phosphatidylinositol signalling reactions.
9295334 1997 The cDNA cloning and characterization of inositol polyphosphate 4-phosphatase type II. Evidence for conserved alternative splicing in the 4-phosphatase family.
7608176 1995 The isolation and characterization of cDNA encoding human and rat brain inositol polyphosphate 4-phosphatase.