Property Summary

NCBI Gene PubMed Count 22
PubMed Score 13.93
PubTator Score 8.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.700 2.4e-04
astrocytic glioma -1.300 7.8e-03
Astrocytoma, Pilocytic -1.600 6.4e-07
atypical teratoid / rhabdoid tumor -2.300 7.0e-11
ependymoma -1.100 1.0e-05
gastric carcinoma 1.100 3.3e-02
glioblastoma -1.500 2.5e-08
group 3 medulloblastoma -1.400 7.5e-03
medulloblastoma, large-cell -1.700 3.2e-05
oligodendroglioma -1.100 1.8e-13
osteosarcoma -1.254 2.1e-03
ovarian cancer -1.300 1.9e-07
Pick disease -1.500 1.2e-02
primitive neuroectodermal tumor -1.400 5.6e-04
psoriasis -2.500 5.2e-04
subependymal giant cell astrocytoma -1.594 2.4e-02
ulcerative colitis 1.500 7.1e-05

Gene RIF (8)

AA Sequence

MTAREHSPRHGARARAMQRASTIDVAADMLGLSLAGNIQDPDEPILEFSLACSELHTPSLDRKPNSFVAV      1 - 70
SVTTPPQAFWTKHAQTEIIEGTNNPIFLSSIAFFQDSLINQMTQVKLSVYDVKDRSQGTMYLLGSGTFIV     71 - 140
KDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQRPPVTRSVDTVNGRMVLPVDESLTEALGIRS    141 - 210
KYASLRKDTLLKSVFGGAICRMYRFPTTDGNHLRILEQMAESVLSLHVPRQFVKLLLEEDAARVCELEEL    211 - 280
GELSPCWESLRRQIVTQYQTIILTYQENLTDLHQYRGPSFKASSLKADKKLEFVPTNLHIQRMRVQDDGG    281 - 350
SDQNYDIVTIGAPAAHCQGFKSGGLRKKLHKFEETKKHFEECCTSSGCQSIIYIPQDVVRAKEIIAQINT    351 - 420
LKTQVSYYAERLSRAAKDRSATGLERTLAILADKTRQLVTVCDCKLLANSIHGLNAARPDYIASKASPTS    421 - 490
TEEEQVMLRNDQDTLMARWTGRNSRSSLQVDWHEEEWEKVWLNVDKSLECIIQRVDKLLQKERLHGEGCE    491 - 560
DVFPCAGSCTSKKGNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTHCSPPPEESSPGEWSEAL    561 - 630
YPLLTTLTDCVAMMSDKAKKAMVFLLMQDSAPTIATYLSLQYRRDVVFCQTLTALICGFIIKLRNCLHDD    631 - 700
GFLRQLYTIGLLAQFESLLSTYGEELAMLEDMSLGIMDLRNVTFKVTQATSSASADMLPVITGNRDGFNV    701 - 770
RVPLPGPLFDALPREIQSGMLLRVQPVLFNVGINEQQTLAERFGDTSLQEVINVESLVRLNSYFEQFKEV    771 - 840
LPEDCLPRSRSQTCLPELLRFLGQNVHARKNKNVDILWQAAEICRRLNGVRFTSCKSAKDRTAMSVTLEQ    841 - 910
CLILQHEHGMAPQVFTQALECMRSEGCRRENTMKNVGSRKYAFNSLQLKAFPKHYRPPEGTYGKVET       911 - 977
//

Text Mined References (26)

PMID Year Title