Property Summary

NCBI Gene PubMed Count 20
PubMed Score 17.22
PubTator Score 20.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.331 2.7e-02
urothelial carcinoma -1.200 3.5e-02
malignant mesothelioma -1.500 9.0e-07
atypical teratoid / rhabdoid tumor -1.400 4.1e-03
sonic hedgehog group medulloblastoma -1.500 5.2e-05
medulloblastoma, large-cell -2.200 5.0e-07
lung cancer -2.800 4.2e-06
lung adenocarcinoma -1.500 4.7e-10
posterior fossa group B ependymoma -1.100 1.4e-05
subependymal giant cell astrocytoma -1.003 4.5e-02
invasive ductal carcinoma -1.400 5.0e-04
lung carcinoma 1.200 2.3e-12
Breast cancer -1.800 9.6e-15
ovarian cancer -1.700 5.4e-06

Synonym

Accession P49441 IPP
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (10)

Gene RIF (9)

PMID Text
24738946 High INPP1 expression is associated with cancer aggressiveness.
23453640 results suggest that genetic variability at rs669838-IMPA2,rs4853694-INPP1, rs1732170-GSK3b and rs11921360-GSK3b genes is associated with a higher risk of attempting suicide in bipolar patients.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
17570738 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16787706 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14671192 Observational study of gene-disease association. (HuGE Navigator)
14574455 Observational study of genotype prevalence, gene-disease association, and gene-gene interaction. (HuGE Navigator)
11901356 association study performed between the 5' regulatory region of the serotonin transporter gene (5-HTTLPR), the inositol polyphosphate 1-phosphatase gene (INPP1) and bipolar disorder using our sample of proband/parent trios

AA Sequence

MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNMENKFP      1 - 70
GLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDSTE     71 - 140
INVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQCVTILIGVYDIQTGVPLMGVINQPFVSRDP    141 - 210
NTLRWKGQCYWGLSYMGTNMHSLQLTISRRNGSETHTGNTGSEAAFSPSFSAVISTSEKETIKAALSRVC    211 - 280
GDRIFGAAGAGYKSLCVVQGLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQ    281 - 350
LVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT                         351 - 399
//

Text Mined References (23)

PMID Year Title
24738946 2014 Inositol phosphate recycling regulates glycolytic and lipid metabolism that drives cancer aggressiveness.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23453640 2013 Genetic variability at IMPA2, INPP1 and GSK3? increases the risk of suicidal behavior in bipolar patients.
21269460 2011 Initial characterization of the human central proteome.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17570738 2007 The pharmacogenetics of lithium response depends upon clinical co-morbidity.
16787706 2006 Association study of the INPP1, 5HTT, BDNF, AP-2beta and GSK-3beta GENE variants and restrospectively scored response to lithium prophylaxis in bipolar disorder.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14671192 2003 Genetic polymorphism PC-1 K121Q and ethnic susceptibility to insulin resistance.
14574455 2003 Evidence for genetic epistasis in human insulin resistance: the combined effect of PC-1 (K121Q) and PPARgamma2 (P12A) polymorphisms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11901356 2002 Manic-depressive illness: an association study with the inositol polyphosphate 1-phosphatase and serotonin transporter genes.
11812139 2002 Crystal structure of an enzyme displaying both inositol-polyphosphate-1-phosphatase and 3'-phosphoadenosine-5'-phosphate phosphatase activities: a novel target of lithium therapy.
10780272 1999 Genomic structure and sequence analysis of a human inositol polyphosphate 1-phosphatase gene (INPP1).
9682271 1998 The polymorphic inositol polyphosphate 1-phosphatase gene as a candidate for pharmacogenetic prediction of lithium-responsive manic-depressive illness.
9599410 1998 Phosphatidylinositol signalling reactions.
8390685 1993 Cloning, heterologous expression, and chromosomal localization of human inositol polyphosphate 1-phosphatase.
2225061 1990 Recent insights in phosphatidylinositol signaling.