Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.26
PubTator Score 4.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Eating disorder 24 3.732 1.9

Expression

 GO Function (1)

Gene RIF (2)

PMID Text
25143393 pathway-guided genome-wide meta-analysis and mutational analysis identified INO80B gene is a susceptibility gene for pre-eclampsia.
22082156 Knockdown of INO80 complex subunit B (INO80B; ZNHIT4) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MSKLWRRGSTSGAMEAPEPGEALELSLAGAHGHGVHKKKHKKHKKKHKKKHHQEEDAGPTQPSPAKPQLK      1 - 70
LKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRAWLDEDSNLSPSPLRDLSGG     71 - 140
LGGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTE    141 - 210
EMLLKREERARKRRLQAARRAEEHKNQTIERLTKTAATSGRGGRGGARGERRGGRAAAPAPMVRYCSGAQ    211 - 280
GSTLSFPPGVPAPTAVSQRPSPSGPPPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQMRLGGPEGPG    281 - 350
SPLLAT                                                                    351 - 356
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25143393 2015 Susceptibility allele-specific loss of miR-1324-mediated silencing of the INO80B chromatin-assembly complex gene in pre-eclampsia.
21303910 2011 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
19095771 2009 PAPA-1 Is a nuclear binding partner of IGFBP-2 and modulates its growth-promoting actions.
18922472 2008 Distinct modes of regulation of the Uch37 deubiquitinating enzyme in the proteasome and in the Ino80 chromatin-remodeling complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15556297 2004 A novel nucleolar protein, PAPA-1, induces growth arrest as a result of cell cycle arrest at the G1 phase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.